Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 3569101..3569705 | Replicon | chromosome |
Accession | NZ_CP128416 | ||
Organism | Rhizobium sp. CSC1952 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QTA58_RS17380 | Protein ID | WP_289669780.1 |
Coordinates | 3569388..3569705 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QTA58_RS17375 | Protein ID | WP_289669778.1 |
Coordinates | 3569101..3569403 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTA58_RS17340 (QTA58_17340) | 3564506..3565129 | + | 624 | WP_289669774.1 | DUF1285 domain-containing protein | - |
QTA58_RS17345 (QTA58_17345) | 3565126..3565761 | + | 636 | WP_085424946.1 | CoA pyrophosphatase | - |
QTA58_RS17350 (QTA58_17350) | 3565758..3567020 | + | 1263 | WP_289669775.1 | CCA tRNA nucleotidyltransferase | - |
QTA58_RS17355 (QTA58_17355) | 3567036..3567230 | - | 195 | WP_085424944.1 | DUF1059 domain-containing protein | - |
QTA58_RS17360 (QTA58_17360) | 3567330..3567599 | - | 270 | WP_085424943.1 | hypothetical protein | - |
QTA58_RS17365 (QTA58_17365) | 3567735..3568646 | - | 912 | WP_289669776.1 | oxygen-dependent coproporphyrinogen oxidase | - |
QTA58_RS17370 (QTA58_17370) | 3568847..3569104 | + | 258 | WP_085424941.1 | hypothetical protein | - |
QTA58_RS17375 (QTA58_17375) | 3569101..3569403 | - | 303 | WP_289669778.1 | putative addiction module antidote protein | Antitoxin |
QTA58_RS17380 (QTA58_17380) | 3569388..3569705 | - | 318 | WP_289669780.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QTA58_RS17385 (QTA58_17385) | 3569767..3570246 | - | 480 | WP_289669782.1 | redox-sensitive transcriptional activator SoxR | - |
QTA58_RS17390 (QTA58_17390) | 3570338..3570913 | + | 576 | WP_289669784.1 | NAD(P)H-dependent oxidoreductase | - |
QTA58_RS17395 (QTA58_17395) | 3570913..3572139 | + | 1227 | WP_289669786.1 | MFS transporter | - |
QTA58_RS17400 (QTA58_17400) | 3572151..3573803 | - | 1653 | WP_289669788.1 | Na/Pi cotransporter family protein | - |
QTA58_RS17405 (QTA58_17405) | 3573943..3574404 | - | 462 | WP_289673199.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11949.66 Da Isoelectric Point: 9.8431
>T284559 WP_289669780.1 NZ_CP128416:c3569705-3569388 [Rhizobium sp. CSC1952]
MFEIYSTKIFRTWVDGLRDRRAVTRIFARIARAEEGNLGDVKPVGEGVSEMRIHYGPGYRVYFTRRGKVVLLLLCGGDKD
SQASDIAEAKRVAQNSGEISEWPWK
MFEIYSTKIFRTWVDGLRDRRAVTRIFARIARAEEGNLGDVKPVGEGVSEMRIHYGPGYRVYFTRRGKVVLLLLCGGDKD
SQASDIAEAKRVAQNSGEISEWPWK
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|