Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3131210..3131787 | Replicon | chromosome |
| Accession | NZ_CP128416 | ||
| Organism | Rhizobium sp. CSC1952 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QTA58_RS15195 | Protein ID | WP_289669494.1 |
| Coordinates | 3131449..3131787 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QTA58_RS15190 | Protein ID | WP_289669493.1 |
| Coordinates | 3131210..3131452 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTA58_RS15165 (QTA58_15165) | 3126406..3126768 | - | 363 | WP_037077221.1 | response regulator CpdR1 | - |
| QTA58_RS15170 (QTA58_15170) | 3127217..3128104 | + | 888 | WP_289669491.1 | N-formylglutamate amidohydrolase | - |
| QTA58_RS15175 (QTA58_15175) | 3128426..3129202 | + | 777 | WP_085420198.1 | histidinol-phosphatase | - |
| QTA58_RS15180 (QTA58_15180) | 3129210..3130178 | - | 969 | WP_289669492.1 | alpha/beta hydrolase | - |
| QTA58_RS15185 (QTA58_15185) | 3130572..3131054 | + | 483 | WP_085420772.1 | Hsp20 family protein | - |
| QTA58_RS15190 (QTA58_15190) | 3131210..3131452 | + | 243 | WP_289669493.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QTA58_RS15195 (QTA58_15195) | 3131449..3131787 | + | 339 | WP_289669494.1 | endoribonuclease MazF | Toxin |
| QTA58_RS15200 (QTA58_15200) | 3131801..3132799 | - | 999 | WP_289669495.1 | bile acid:sodium symporter family protein | - |
| QTA58_RS15205 (QTA58_15205) | 3132888..3133733 | + | 846 | WP_289669496.1 | LysR family transcriptional regulator | - |
| QTA58_RS15210 (QTA58_15210) | 3133811..3134863 | - | 1053 | WP_289669497.1 | low specificity L-threonine aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12277.12 Da Isoelectric Point: 10.2276
>T284557 WP_289669494.1 NZ_CP128416:3131449-3131787 [Rhizobium sp. CSC1952]
MTSASYVPDAGDIVWLQFSPQAGHGQVGHRPAVVLTPASYNRFRLMLCCPMTTKRKGYPFEVAIAGDRESVVLADQVKSL
DWRARNAQRKGRVSDHELGEVRAKAAALIGKP
MTSASYVPDAGDIVWLQFSPQAGHGQVGHRPAVVLTPASYNRFRLMLCCPMTTKRKGYPFEVAIAGDRESVVLADQVKSL
DWRARNAQRKGRVSDHELGEVRAKAAALIGKP
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|