Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 2260143..2260674 | Replicon | chromosome |
Accession | NZ_CP128416 | ||
Organism | Rhizobium sp. CSC1952 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QTA58_RS11110 | Protein ID | WP_289672801.1 |
Coordinates | 2260378..2260674 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QTA58_RS11105 | Protein ID | WP_289673126.1 |
Coordinates | 2260143..2260388 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTA58_RS11080 (QTA58_11080) | 2255513..2256748 | + | 1236 | WP_085419698.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
QTA58_RS11085 (QTA58_11085) | 2256850..2257203 | + | 354 | WP_085419697.1 | YciI family protein | - |
QTA58_RS11090 (QTA58_11090) | 2257203..2258468 | + | 1266 | WP_289672799.1 | sigma factor | - |
QTA58_RS11095 (QTA58_11095) | 2258472..2259113 | - | 642 | WP_085419695.1 | LysE family translocator | - |
QTA58_RS11100 (QTA58_11100) | 2259185..2260042 | - | 858 | WP_289672800.1 | SDR family NAD(P)-dependent oxidoreductase | - |
QTA58_RS11105 (QTA58_11105) | 2260143..2260388 | + | 246 | WP_289673126.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QTA58_RS11110 (QTA58_11110) | 2260378..2260674 | + | 297 | WP_289672801.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QTA58_RS11115 (QTA58_11115) | 2260788..2262011 | + | 1224 | WP_085419931.1 | argininosuccinate synthase | - |
QTA58_RS11120 (QTA58_11120) | 2262067..2263251 | - | 1185 | WP_289673127.1 | multidrug effflux MFS transporter | - |
QTA58_RS11125 (QTA58_11125) | 2263277..2263738 | - | 462 | WP_085419691.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QTA58_RS11130 (QTA58_11130) | 2263892..2264533 | + | 642 | WP_289672802.1 | LysE family translocator | - |
QTA58_RS11135 (QTA58_11135) | 2264551..2264976 | - | 426 | WP_085419689.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11290.00 Da Isoelectric Point: 10.5374
>T284556 WP_289672801.1 NZ_CP128416:2260378-2260674 [Rhizobium sp. CSC1952]
MAPKRYRLSPQARKDLEGIWLYTFKTWSRVQADGYYDELIAAVADLANGSKRGRMIDNIRSGYLSLSYGSHFIIYKQGAT
GINVVRILHQRMNISRHL
MAPKRYRLSPQARKDLEGIWLYTFKTWSRVQADGYYDELIAAVADLANGSKRGRMIDNIRSGYLSLSYGSHFIIYKQGAT
GINVVRILHQRMNISRHL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|