Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-dnstrm_HI1420
Location 1289431..1290014 Replicon chromosome
Accession NZ_CP128416
Organism Rhizobium sp. CSC1952

Toxin (Protein)


Gene name PumA Uniprot ID -
Locus tag QTA58_RS06620 Protein ID WP_289672163.1
Coordinates 1289431..1289727 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag QTA58_RS06625 Protein ID WP_289673043.1
Coordinates 1289727..1290014 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTA58_RS06580 (QTA58_06580) 1284910..1285434 + 525 WP_289672159.1 2'-5' RNA ligase family protein -
QTA58_RS06585 (QTA58_06585) 1285518..1286000 + 483 WP_085422051.1 VOC family protein -
QTA58_RS06590 (QTA58_06590) 1286164..1286328 - 165 WP_200814075.1 hypothetical protein -
QTA58_RS06595 (QTA58_06595) 1286503..1286850 + 348 WP_085422050.1 ArsC family reductase -
QTA58_RS06600 (QTA58_06600) 1286890..1287318 + 429 WP_289672160.1 putative toxin-antitoxin system toxin component, PIN family -
QTA58_RS06605 (QTA58_06605) 1287315..1287545 + 231 WP_085422048.1 ribbon-helix-helix protein, CopG family -
QTA58_RS06610 (QTA58_06610) 1287552..1288025 + 474 WP_289672161.1 Cys-tRNA(Pro) deacylase -
QTA58_RS06615 (QTA58_06615) 1288128..1289381 + 1254 WP_289672162.1 aminopeptidase -
QTA58_RS06620 (QTA58_06620) 1289431..1289727 + 297 WP_289672163.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QTA58_RS06625 (QTA58_06625) 1289727..1290014 + 288 WP_289673043.1 putative addiction module antidote protein Antitoxin
QTA58_RS06630 (QTA58_06630) 1290122..1291063 + 942 WP_289672164.1 cyclase family protein -
QTA58_RS06635 (QTA58_06635) 1291097..1291690 - 594 WP_289672165.1 NAD(P)H-dependent oxidoreductase -
QTA58_RS06640 (QTA58_06640) 1291690..1293297 - 1608 WP_289672166.1 exodeoxyribonuclease VII large subunit -
QTA58_RS06645 (QTA58_06645) 1293603..1293866 + 264 WP_085422041.1 hypothetical protein -
QTA58_RS06650 (QTA58_06650) 1293885..1294154 + 270 WP_289672167.1 hypothetical protein -
QTA58_RS06655 (QTA58_06655) 1294293..1294523 + 231 WP_085422039.1 hypothetical protein -
QTA58_RS06660 (QTA58_06660) 1294520..1294885 + 366 WP_289672168.1 GtrA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(3-96)

Antitoxin

Uncharacterized protein HI1420

(5-91)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11105.71 Da        Isoelectric Point: 10.2220

>T284554 WP_289672163.1 NZ_CP128416:1289431-1289727 [Rhizobium sp. CSC1952]
VFELKQTEAFRKWRTGLRDDRARAMIASRLDRLAFGHAGDVAPVGDGVSELRIHYGPGYRIYFQQRGNLLIVLLCGGDKS
SQARDIKLAKKLSQEWSE

Download         Length: 297 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10067.41 Da        Isoelectric Point: 5.0495

>AT284554 WP_289673043.1 NZ_CP128416:1289727-1290014 [Rhizobium sp. CSC1952]
MAEKLSNYDPAEDLGSDEAIATFMAEAFETEDAAYIAHALGVVARAKGMTQIAKDTGLSREQLYRSFSATGNPTLKTTIA
VMKSLGIGLTAKVHS

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References