Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 460825..461572 | Replicon | chromosome |
| Accession | NZ_CP128416 | ||
| Organism | Rhizobium sp. CSC1952 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | QTA58_RS02370 | Protein ID | WP_289671569.1 |
| Coordinates | 460825..461325 (-) | Length | 167 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | QTA58_RS02375 | Protein ID | WP_289671570.1 |
| Coordinates | 461330..461572 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTA58_RS02330 (QTA58_02330) | 455947..456390 | - | 444 | WP_289671561.1 | NlpC/P60 family protein | - |
| QTA58_RS02335 (QTA58_02335) | 456387..457262 | - | 876 | WP_289671562.1 | DUF2163 domain-containing protein | - |
| QTA58_RS02340 (QTA58_02340) | 457259..457897 | - | 639 | WP_289671563.1 | DUF2460 domain-containing protein | - |
| QTA58_RS02345 (QTA58_02345) | 457919..458455 | - | 537 | WP_289671564.1 | phage tail tape measure protein | - |
| QTA58_RS02350 (QTA58_02350) | 458539..458757 | - | 219 | WP_289671565.1 | phage tail assembly chaperone | - |
| QTA58_RS02355 (QTA58_02355) | 458754..459119 | - | 366 | WP_289671566.1 | gene transfer agent family protein | - |
| QTA58_RS02360 (QTA58_02360) | 459119..459526 | - | 408 | WP_289671567.1 | phage major tail protein, TP901-1 family | - |
| QTA58_RS02365 (QTA58_02365) | 459620..460828 | + | 1209 | WP_289671568.1 | MFS transporter | - |
| QTA58_RS02370 (QTA58_02370) | 460825..461325 | - | 501 | WP_289671569.1 | GNAT family N-acetyltransferase | Toxin |
| QTA58_RS02375 (QTA58_02375) | 461330..461572 | - | 243 | WP_289671570.1 | DUF1778 domain-containing protein | Antitoxin |
| QTA58_RS02380 (QTA58_02380) | 461685..462083 | - | 399 | WP_289671571.1 | DUF3168 domain-containing protein | - |
| QTA58_RS02385 (QTA58_02385) | 462080..462412 | - | 333 | WP_289671572.1 | phage head closure protein | - |
| QTA58_RS02390 (QTA58_02390) | 462412..462981 | - | 570 | WP_289671573.1 | head-tail connector protein | - |
| QTA58_RS02395 (QTA58_02395) | 463120..464391 | - | 1272 | WP_289671574.1 | phage major capsid protein | - |
| QTA58_RS02400 (QTA58_02400) | 464388..464969 | - | 582 | WP_085422756.1 | HK97 family phage prohead protease | - |
| QTA58_RS02405 (QTA58_02405) | 465232..465552 | - | 321 | WP_085422755.1 | DUF6107 family protein | - |
| QTA58_RS02410 (QTA58_02410) | 466077..466337 | - | 261 | WP_085422754.1 | ribbon-helix-helix protein, CopG family | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 451812..482046 | 30234 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18220.21 Da Isoelectric Point: 9.4334
>T284552 WP_289671569.1 NZ_CP128416:c461325-460825 [Rhizobium sp. CSC1952]
MYRKPVPLNEQHRLEGFDSGKPALDAFLKEMALHNQAQGYTRTFVIADADFRVVGYHSLCAGMISREHAPRQVKSHQAPG
EIPVALLARLAVDRRCQGLGLGGELLKNALLAVVATAEVVAFRAVMVHALDEDAVRFYLKYGFRQAKGLERTLLLPVKDI
VASIGA
MYRKPVPLNEQHRLEGFDSGKPALDAFLKEMALHNQAQGYTRTFVIADADFRVVGYHSLCAGMISREHAPRQVKSHQAPG
EIPVALLARLAVDRRCQGLGLGGELLKNALLAVVATAEVVAFRAVMVHALDEDAVRFYLKYGFRQAKGLERTLLLPVKDI
VASIGA
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|