Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 561821..562474 | Replicon | chromosome |
Accession | NZ_CP128411 | ||
Organism | Brevibacillus brevis strain HNCS-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | J2PLP3 |
Locus tag | QN310_RS03040 | Protein ID | WP_005830205.1 |
Coordinates | 562124..562474 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | J2GZH3 |
Locus tag | QN310_RS03035 | Protein ID | WP_007721089.1 |
Coordinates | 561821..562120 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN310_RS03020 (QN310_03020) | 558386..559759 | + | 1374 | WP_289675964.1 | hypothetical protein | - |
QN310_RS03025 (QN310_03025) | 559945..560385 | + | 441 | WP_012684242.1 | hypothetical protein | - |
QN310_RS03030 (QN310_03030) | 560388..561590 | + | 1203 | WP_289675965.1 | alanine racemase | - |
QN310_RS03035 (QN310_03035) | 561821..562120 | + | 300 | WP_007721089.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QN310_RS03040 (QN310_03040) | 562124..562474 | + | 351 | WP_005830205.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QN310_RS03045 (QN310_03045) | 562767..563111 | + | 345 | WP_235442569.1 | anti-sigma regulatory factor | - |
QN310_RS03050 (QN310_03050) | 563117..564118 | + | 1002 | WP_289675966.1 | PP2C family protein-serine/threonine phosphatase | - |
QN310_RS03055 (QN310_03055) | 564142..564468 | + | 327 | WP_012684246.1 | anti-sigma factor antagonist | - |
QN310_RS03060 (QN310_03060) | 564468..564962 | + | 495 | WP_087345518.1 | anti-sigma B factor RsbW | - |
QN310_RS03065 (QN310_03065) | 564931..565719 | + | 789 | WP_172142754.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12917.86 Da Isoelectric Point: 4.8435
>T284549 WP_005830205.1 NZ_CP128411:562124-562474 [Brevibacillus brevis]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|