Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2775732..2776529 Replicon chromosome
Accession NZ_CP128389
Organism Staphylococcus aureus strain 21-024

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag QTN91_RS13570 Protein ID WP_031794911.1
Coordinates 2775732..2776193 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag QTN91_RS13575 Protein ID WP_001260487.1
Coordinates 2776206..2776529 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTN91_RS13545 (QTN91_13545) 2770742..2772769 + 2028 WP_014532489.1 hypothetical protein -
QTN91_RS13550 (QTN91_13550) 2772812..2774017 - 1206 WP_031585161.1 tyrosine-type recombinase/integrase -
QTN91_RS13555 (QTN91_13555) 2774143..2774757 + 615 WP_000191464.1 hypothetical protein -
QTN91_RS13560 (QTN91_13560) 2774754..2774900 - 147 WP_001795334.1 hypothetical protein -
QTN91_RS13565 (QTN91_13565) 2775130..2775714 - 585 WP_000825948.1 hypothetical protein -
QTN91_RS13570 (QTN91_13570) 2775732..2776193 - 462 WP_031794911.1 toxin Toxin
QTN91_RS13575 (QTN91_13575) 2776206..2776529 - 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
QTN91_RS13580 (QTN91_13580) 2776693..2776941 + 249 WP_000272859.1 helix-turn-helix transcriptional regulator -
QTN91_RS13585 (QTN91_13585) 2776954..2777397 + 444 WP_000435357.1 hypothetical protein -
QTN91_RS13590 (QTN91_13590) 2777412..2777561 + 150 WP_000771849.1 hypothetical protein -
QTN91_RS13595 (QTN91_13595) 2777602..2777814 - 213 WP_000362644.1 hypothetical protein -
QTN91_RS13600 (QTN91_13600) 2777884..2778081 + 198 WP_001148860.1 hypothetical protein -
QTN91_RS13605 (QTN91_13605) 2778068..2778448 - 381 WP_000773059.1 DUF2513 domain-containing protein -
QTN91_RS13610 (QTN91_13610) 2778515..2778760 + 246 WP_001025401.1 DUF2829 domain-containing protein -
QTN91_RS13615 (QTN91_13615) 2778729..2779094 - 366 WP_001128433.1 hypothetical protein -
QTN91_RS13620 (QTN91_13620) 2779149..2779364 + 216 WP_001097552.1 hypothetical protein -
QTN91_RS13625 (QTN91_13625) 2779391..2779654 + 264 WP_001596347.1 helix-turn-helix domain-containing protein -
QTN91_RS13630 (QTN91_13630) 2779667..2779828 + 162 WP_001285948.1 DUF1270 domain-containing protein -
QTN91_RS13635 (QTN91_13635) 2779907..2780230 + 324 WP_000174994.1 hypothetical protein -
QTN91_RS13640 (QTN91_13640) 2780245..2780607 + 363 WP_000985976.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18076.39 Da        Isoelectric Point: 4.5941

>T284544 WP_031794911.1 NZ_CP128389:c2776193-2775732 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVESYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT284544 WP_001260487.1 NZ_CP128389:c2776529-2776206 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References