Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2254471..2255000 | Replicon | chromosome |
Accession | NZ_CP128389 | ||
Organism | Staphylococcus aureus strain 21-024 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QTN91_RS10835 | Protein ID | WP_000621175.1 |
Coordinates | 2254638..2255000 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | QTN91_RS10830 | Protein ID | WP_000948331.1 |
Coordinates | 2254471..2254641 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN91_RS10800 (QTN91_10800) | 2249507..2250067 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
QTN91_RS10805 (QTN91_10805) | 2250276..2250755 | + | 480 | WP_001287081.1 | hypothetical protein | - |
QTN91_RS10810 (QTN91_10810) | 2250748..2252325 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
QTN91_RS10815 (QTN91_10815) | 2252318..2252809 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
QTN91_RS10820 (QTN91_10820) | 2252813..2253172 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
QTN91_RS10825 (QTN91_10825) | 2253238..2254386 | + | 1149 | WP_001281139.1 | alanine racemase | - |
QTN91_RS10830 (QTN91_10830) | 2254471..2254641 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QTN91_RS10835 (QTN91_10835) | 2254638..2255000 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QTN91_RS10840 (QTN91_10840) | 2255350..2256351 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
QTN91_RS10845 (QTN91_10845) | 2256470..2256796 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
QTN91_RS10850 (QTN91_10850) | 2256798..2257277 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
QTN91_RS10855 (QTN91_10855) | 2257252..2258022 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T284542 WP_000621175.1 NZ_CP128389:2254638-2255000 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|