Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 700057..700533 Replicon chromosome
Accession NZ_CP128389
Organism Staphylococcus aureus strain 21-024

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QTN91_RS03295 Protein ID WP_000052076.1
Coordinates 700345..700533 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QTN91_RS03290 Protein ID WP_001059690.1
Coordinates 700057..700317 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTN91_RS03255 (QTN91_03255) 695455..696171 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
QTN91_RS03260 (QTN91_03260) 696319..696741 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
QTN91_RS03265 (QTN91_03265) 697140..697634 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
QTN91_RS03270 (QTN91_03270) 697783..698400 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
QTN91_RS03275 (QTN91_03275) 698473..699054 - 582 WP_001140696.1 histidine phosphatase family protein -
QTN91_RS03280 (QTN91_03280) 699279..699515 + 237 WP_000368687.1 hypothetical protein -
QTN91_RS03285 (QTN91_03285) 699512..699715 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QTN91_RS03290 (QTN91_03290) 700057..700317 + 261 WP_001059690.1 hypothetical protein Antitoxin
QTN91_RS03295 (QTN91_03295) 700345..700533 + 189 WP_000052076.1 hypothetical protein Toxin
QTN91_RS03300 (QTN91_03300) 700721..701290 + 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
QTN91_RS03305 (QTN91_03305) 701378..701662 + 285 WP_001004403.1 hypothetical protein -
QTN91_RS03310 (QTN91_03310) 701723..701941 + 219 WP_000005881.1 hypothetical protein -
QTN91_RS03315 (QTN91_03315) 702438..702638 - 201 WP_001059082.1 cold-shock protein -
QTN91_RS03320 (QTN91_03320) 702995..703681 - 687 WP_001574556.1 thermonuclease family protein -
QTN91_RS03325 (QTN91_03325) 704022..704504 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T284536 WP_000052076.1 NZ_CP128389:700345-700533 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT284536 WP_001059690.1 NZ_CP128389:700057-700317 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References