Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2787900..2788697 Replicon chromosome
Accession NZ_CP128388
Organism Staphylococcus aureus strain 21-074

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag QTN92_RS13585 Protein ID WP_000525004.1
Coordinates 2787900..2788361 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag QTN92_RS13590 Protein ID WP_282803398.1
Coordinates 2788374..2788697 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTN92_RS13560 (QTN92_13560) 2782911..2784937 + 2027 Protein_2630 hypothetical protein -
QTN92_RS13565 (QTN92_13565) 2784980..2786185 - 1206 WP_031585161.1 tyrosine-type recombinase/integrase -
QTN92_RS13570 (QTN92_13570) 2786311..2786925 + 615 WP_000191459.1 hypothetical protein -
QTN92_RS13575 (QTN92_13575) 2786922..2787068 - 147 WP_078098719.1 hypothetical protein -
QTN92_RS13580 (QTN92_13580) 2787298..2787882 - 585 WP_000825948.1 hypothetical protein -
QTN92_RS13585 (QTN92_13585) 2787900..2788361 - 462 WP_000525004.1 hypothetical protein Toxin
QTN92_RS13590 (QTN92_13590) 2788374..2788697 - 324 WP_282803398.1 helix-turn-helix transcriptional regulator Antitoxin
QTN92_RS13595 (QTN92_13595) 2788862..2789110 + 249 WP_282803397.1 helix-turn-helix transcriptional regulator -
QTN92_RS13600 (QTN92_13600) 2789126..2789869 + 744 WP_282803396.1 phage antirepressor KilAC domain-containing protein -
QTN92_RS13605 (QTN92_13605) 2789909..2790052 + 144 WP_031797335.1 hypothetical protein -
QTN92_RS13610 (QTN92_13610) 2790042..2790251 - 210 WP_000642492.1 hypothetical protein -
QTN92_RS13615 (QTN92_13615) 2790307..2790552 + 246 WP_001025401.1 DUF2829 domain-containing protein -
QTN92_RS13620 (QTN92_13620) 2790521..2790886 - 366 WP_016170627.1 hypothetical protein -
QTN92_RS13625 (QTN92_13625) 2790941..2791156 + 216 WP_001097552.1 hypothetical protein -
QTN92_RS13630 (QTN92_13630) 2791181..2791444 + 264 WP_016187436.1 helix-turn-helix domain-containing protein -
QTN92_RS13635 (QTN92_13635) 2791457..2791618 + 162 WP_001285948.1 DUF1270 domain-containing protein -
QTN92_RS13640 (QTN92_13640) 2791697..2792020 + 324 WP_000174994.1 hypothetical protein -
QTN92_RS13645 (QTN92_13645) 2792035..2792397 + 363 WP_000985976.1 hypothetical protein -
QTN92_RS13650 (QTN92_13650) 2792394..2793560 + 1167 WP_015581855.1 DUF2800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T284533 WP_000525004.1 NZ_CP128388:c2788361-2787900 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12323.98 Da        Isoelectric Point: 8.4751

>AT284533 WP_282803398.1 NZ_CP128388:c2788697-2788374 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNINLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALNVTPESLLLKNKQPETEIQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure

References