Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 699885..700361 Replicon chromosome
Accession NZ_CP128388
Organism Staphylococcus aureus strain 21-074

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QTN92_RS03290 Protein ID WP_000052076.1
Coordinates 700173..700361 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QTN92_RS03285 Protein ID WP_001059690.1
Coordinates 699885..700145 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTN92_RS03250 (QTN92_03250) 695283..695999 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
QTN92_RS03255 (QTN92_03255) 696147..696569 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
QTN92_RS03260 (QTN92_03260) 696968..697462 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
QTN92_RS03265 (QTN92_03265) 697611..698228 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
QTN92_RS03270 (QTN92_03270) 698301..698882 - 582 WP_001140696.1 histidine phosphatase family protein -
QTN92_RS03275 (QTN92_03275) 699107..699343 + 237 WP_000368687.1 hypothetical protein -
QTN92_RS03280 (QTN92_03280) 699340..699543 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QTN92_RS03285 (QTN92_03285) 699885..700145 + 261 WP_001059690.1 hypothetical protein Antitoxin
QTN92_RS03290 (QTN92_03290) 700173..700361 + 189 WP_000052076.1 hypothetical protein Toxin
QTN92_RS03295 (QTN92_03295) 700549..701118 + 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
QTN92_RS03300 (QTN92_03300) 701206..701490 + 285 WP_001004403.1 hypothetical protein -
QTN92_RS03305 (QTN92_03305) 701551..701769 + 219 WP_000005881.1 hypothetical protein -
QTN92_RS03310 (QTN92_03310) 702266..702466 - 201 WP_001059082.1 cold-shock protein -
QTN92_RS03315 (QTN92_03315) 702823..703509 - 687 WP_001574556.1 thermonuclease family protein -
QTN92_RS03320 (QTN92_03320) 703850..704332 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T284525 WP_000052076.1 NZ_CP128388:700173-700361 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT284525 WP_001059690.1 NZ_CP128388:699885-700145 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References