Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2787886..2788683 Replicon chromosome
Accession NZ_CP128387
Organism Staphylococcus aureus strain 22-042

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag QTN90_RS13645 Protein ID WP_000525004.1
Coordinates 2787886..2788347 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag QTN90_RS13650 Protein ID WP_282803398.1
Coordinates 2788360..2788683 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTN90_RS13620 (QTN90_13620) 2782897..2784923 + 2027 Protein_2642 hypothetical protein -
QTN90_RS13625 (QTN90_13625) 2784966..2786171 - 1206 WP_031585161.1 tyrosine-type recombinase/integrase -
QTN90_RS13630 (QTN90_13630) 2786297..2786911 + 615 WP_000191459.1 hypothetical protein -
QTN90_RS13635 (QTN90_13635) 2786908..2787054 - 147 WP_078098719.1 hypothetical protein -
QTN90_RS13640 (QTN90_13640) 2787284..2787868 - 585 WP_000825948.1 hypothetical protein -
QTN90_RS13645 (QTN90_13645) 2787886..2788347 - 462 WP_000525004.1 hypothetical protein Toxin
QTN90_RS13650 (QTN90_13650) 2788360..2788683 - 324 WP_282803398.1 helix-turn-helix transcriptional regulator Antitoxin
QTN90_RS13655 (QTN90_13655) 2788848..2789096 + 249 WP_282803397.1 helix-turn-helix transcriptional regulator -
QTN90_RS13660 (QTN90_13660) 2789112..2789855 + 744 WP_282803396.1 phage antirepressor KilAC domain-containing protein -
QTN90_RS13665 (QTN90_13665) 2789895..2790038 + 144 WP_031797335.1 hypothetical protein -
QTN90_RS13670 (QTN90_13670) 2790028..2790237 - 210 WP_000642492.1 hypothetical protein -
QTN90_RS13675 (QTN90_13675) 2790293..2790538 + 246 WP_001025401.1 DUF2829 domain-containing protein -
QTN90_RS13680 (QTN90_13680) 2790507..2790872 - 366 WP_016170627.1 hypothetical protein -
QTN90_RS13685 (QTN90_13685) 2790927..2791142 + 216 WP_001097552.1 hypothetical protein -
QTN90_RS13690 (QTN90_13690) 2791167..2791430 + 264 WP_016187436.1 helix-turn-helix domain-containing protein -
QTN90_RS13695 (QTN90_13695) 2791443..2791604 + 162 WP_001285948.1 DUF1270 domain-containing protein -
QTN90_RS13700 (QTN90_13700) 2791683..2792006 + 324 WP_000174994.1 hypothetical protein -
QTN90_RS13705 (QTN90_13705) 2792021..2792383 + 363 WP_000985976.1 hypothetical protein -
QTN90_RS13710 (QTN90_13710) 2792380..2793546 + 1167 WP_015581855.1 DUF2800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T284522 WP_000525004.1 NZ_CP128387:c2788347-2787886 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12323.98 Da        Isoelectric Point: 8.4751

>AT284522 WP_282803398.1 NZ_CP128387:c2788683-2788360 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNINLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALNVTPESLLLKNKQPETEIQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure

References