Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2259822..2260351 | Replicon | chromosome |
Accession | NZ_CP128387 | ||
Organism | Staphylococcus aureus strain 22-042 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QTN90_RS10865 | Protein ID | WP_000621175.1 |
Coordinates | 2259989..2260351 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | QTN90_RS10860 | Protein ID | WP_000948331.1 |
Coordinates | 2259822..2259992 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN90_RS10830 (QTN90_10830) | 2254858..2255418 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
QTN90_RS10835 (QTN90_10835) | 2255627..2256106 | + | 480 | WP_001287081.1 | hypothetical protein | - |
QTN90_RS10840 (QTN90_10840) | 2256099..2257676 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
QTN90_RS10845 (QTN90_10845) | 2257669..2258160 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
QTN90_RS10850 (QTN90_10850) | 2258164..2258523 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
QTN90_RS10855 (QTN90_10855) | 2258589..2259737 | + | 1149 | WP_001281139.1 | alanine racemase | - |
QTN90_RS10860 (QTN90_10860) | 2259822..2259992 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QTN90_RS10865 (QTN90_10865) | 2259989..2260351 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QTN90_RS10870 (QTN90_10870) | 2260701..2261702 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
QTN90_RS10875 (QTN90_10875) | 2261821..2262147 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
QTN90_RS10880 (QTN90_10880) | 2262149..2262628 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
QTN90_RS10885 (QTN90_10885) | 2262603..2263373 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T284520 WP_000621175.1 NZ_CP128387:2259989-2260351 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|