Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 19528..20053 Replicon plasmid pIncI1-ST12
Accession NZ_CP128262
Organism Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QR684_RS23195 Protein ID WP_001159871.1
Coordinates 19748..20053 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QR684_RS23190 Protein ID WP_000813630.1
Coordinates 19528..19746 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QR684_RS23160 (14529) 14529..15119 - 591 WP_000194550.1 hypothetical protein -
QR684_RS23165 (15119) 15119..15373 - 255 WP_000343103.1 hypothetical protein -
QR684_RS23170 (15725) 15725..16726 + 1002 WP_000774875.1 DUF4238 domain-containing protein -
QR684_RS23175 (16902) 16902..17246 - 345 WP_000793307.1 hypothetical protein -
QR684_RS23180 (17745) 17745..17999 - 255 WP_046340923.1 hypothetical protein -
QR684_RS23185 (18044) 18044..18970 - 927 WP_001290416.1 hypothetical protein -
QR684_RS23190 (19528) 19528..19746 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QR684_RS23195 (19748) 19748..20053 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QR684_RS23200 (20054) 20054..20860 + 807 WP_000016969.1 site-specific integrase -
QR684_RS23205 (21040) 21040..21684 + 645 WP_001144036.1 ParA family protein -
QR684_RS23210 (21771) 21771..22079 + 309 WP_000030199.1 hypothetical protein -
QR684_RS23215 (22493) 22493..23473 + 981 WP_000688514.1 plasmid segregation protein ParM -
QR684_RS23220 (23466) 23466..23882 + 417 WP_001278818.1 plasmid partitioning/stability family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCMY-2 - 1..101492 101492


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T284509 WP_001159871.1 NZ_CP128262:19748-20053 [Salmonella enterica subsp. enterica serovar Heidelberg]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT284509 WP_000813630.1 NZ_CP128262:19528-19746 [Salmonella enterica subsp. enterica serovar Heidelberg]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References