Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelE-RHH |
Location | 1986..2533 | Replicon | plasmid pIncI1-ST12 |
Accession | NZ_CP128262 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QR684_RS23085 | Protein ID | WP_244442846.1 |
Coordinates | 2255..2533 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | E1QMW3 |
Locus tag | QR684_RS23080 | Protein ID | WP_000079941.1 |
Coordinates | 1986..2255 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR684_RS23075 (46) | 46..1077 | + | 1032 | WP_000907873.1 | plasmid replication initiator RepA | - |
QR684_RS23080 (1986) | 1986..2255 | + | 270 | WP_000079941.1 | type II toxin-antitoxin system antitoxin YacA | Antitoxin |
QR684_RS23085 (2255) | 2255..2533 | + | 279 | WP_244442846.1 | type II toxin-antitoxin system toxin YacB | Toxin |
QR684_RS23090 (2573) | 2573..3421 | + | 849 | WP_001057991.1 | 3'-5' exonuclease | - |
QR684_RS23095 (3538) | 3538..4011 | + | 474 | WP_001334658.1 | hypothetical protein | - |
QR684_RS23100 (4488) | 4488..4754 | - | 267 | WP_000955263.1 | hypothetical protein | - |
QR684_RS23105 (4754) | 4754..5248 | - | 495 | WP_001459505.1 | hypothetical protein | - |
QR684_RS23110 (5304) | 5304..5906 | - | 603 | WP_000517695.1 | ProQ/FINO family protein | - |
QR684_RS23115 (6260) | 6260..7144 | + | 885 | Protein_8 | protein YagA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCMY-2 | - | 1..101492 | 101492 | |
- | flank | IS/Tn | blaCMY-2 | - | 7327..10058 | 2731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10761.43 Da Isoelectric Point: 9.7617
>T284508 WP_244442846.1 NZ_CP128262:2255-2533 [Salmonella enterica subsp. enterica serovar Heidelberg]
MEIFWTMLASQDRKRIRKYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
MEIFWTMLASQDRKRIRKYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|