Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4147415..4147931 | Replicon | chromosome |
Accession | NZ_CP128261 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
Locus tag | QR684_RS20175 | Protein ID | WP_000220577.1 |
Coordinates | 4147415..4147699 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | QR684_RS20180 | Protein ID | WP_000212724.1 |
Coordinates | 4147689..4147931 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR684_RS20160 (4142531) | 4142531..4144183 | + | 1653 | WP_000155047.1 | alpha,alpha-phosphotrehalase | - |
QR684_RS20165 (4144592) | 4144592..4146730 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QR684_RS20170 (4146947) | 4146947..4147411 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QR684_RS20175 (4147415) | 4147415..4147699 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QR684_RS20180 (4147689) | 4147689..4147931 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QR684_RS20185 (4148009) | 4148009..4149922 | - | 1914 | WP_001212135.1 | BglG family transcription antiterminator | - |
QR684_RS20190 (4149939) | 4149939..4150679 | - | 741 | WP_000779250.1 | KDGP aldolase family protein | - |
QR684_RS20195 (4150676) | 4150676..4151794 | - | 1119 | WP_001139173.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
QR684_RS20200 (4151778) | 4151778..4152911 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T284505 WP_000220577.1 NZ_CP128261:c4147699-4147415 [Salmonella enterica subsp. enterica serovar Heidelberg]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |