Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3406970..3407590 | Replicon | chromosome |
Accession | NZ_CP128261 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | QR684_RS16645 | Protein ID | WP_001280991.1 |
Coordinates | 3407372..3407590 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | QR684_RS16640 | Protein ID | WP_000344807.1 |
Coordinates | 3406970..3407344 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR684_RS16630 (3402109) | 3402109..3403302 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QR684_RS16635 (3403325) | 3403325..3406474 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
QR684_RS16640 (3406970) | 3406970..3407344 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
QR684_RS16645 (3407372) | 3407372..3407590 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
QR684_RS16650 (3407769) | 3407769..3408320 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
QR684_RS16655 (3408437) | 3408437..3408907 | + | 471 | WP_000136181.1 | YlaC family protein | - |
QR684_RS16660 (3408963) | 3408963..3409103 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
QR684_RS16665 (3409109) | 3409109..3409369 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
QR684_RS16670 (3409594) | 3409594..3411144 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
QR684_RS16680 (3411375) | 3411375..3411764 | + | 390 | WP_000961285.1 | MGMT family protein | - |
QR684_RS16685 (3411797) | 3411797..3412366 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T284501 WP_001280991.1 NZ_CP128261:3407372-3407590 [Salmonella enterica subsp. enterica serovar Heidelberg]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT284501 WP_000344807.1 NZ_CP128261:3406970-3407344 [Salmonella enterica subsp. enterica serovar Heidelberg]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|