Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2351968..2352490 | Replicon | chromosome |
Accession | NZ_CP128261 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5V5H0Y9 |
Locus tag | QR684_RS11320 | Protein ID | WP_000221348.1 |
Coordinates | 2352206..2352490 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | QR684_RS11315 | Protein ID | WP_000885424.1 |
Coordinates | 2351968..2352216 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR684_RS11290 (2347758) | 2347758..2348666 | - | 909 | WP_001176641.1 | LysR family transcriptional regulator | - |
QR684_RS11295 (2349477) | 2349477..2350245 | + | 769 | Protein_2207 | helix-turn-helix domain-containing protein | - |
QR684_RS11300 (2350301) | 2350301..2351208 | - | 908 | Protein_2208 | hypothetical protein | - |
QR684_RS11305 (2351291) | 2351291..2351611 | - | 321 | WP_001531540.1 | DUF1493 family protein | - |
QR684_RS11310 (2351601) | 2351601..2351816 | - | 216 | WP_000206207.1 | hypothetical protein | - |
QR684_RS11315 (2351968) | 2351968..2352216 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QR684_RS11320 (2352206) | 2352206..2352490 | + | 285 | WP_000221348.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QR684_RS11325 (2352661) | 2352661..2353050 | + | 390 | WP_001531585.1 | RidA family protein | - |
QR684_RS11330 (2353108) | 2353108..2354181 | - | 1074 | WP_000954686.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
QR684_RS11335 (2354373) | 2354373..2354861 | - | 489 | WP_001293629.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QR684_RS11340 (2354906) | 2354906..2356414 | + | 1509 | WP_000214838.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2348822..2359271 | 10449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11093.88 Da Isoelectric Point: 10.6500
>T284500 WP_000221348.1 NZ_CP128261:2352206-2352490 [Salmonella enterica subsp. enterica serovar Heidelberg]
MTYKLAFNESALKEWKKMGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKMGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5V5H0Y9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |