Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2068437..2069053 Replicon chromosome
Accession NZ_CP128260
Organism Pseudomonas fluorescens strain PH.SM

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QR290_RS09425 Protein ID WP_085611511.1
Coordinates 2068437..2068649 (+) Length 71 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag QR290_RS09430 Protein ID WP_085699412.1
Coordinates 2068649..2069053 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QR290_RS09390 (QR290_09390) 2063555..2064091 + 537 WP_011333088.1 DsbE family thiol:disulfide interchange protein -
QR290_RS09395 (QR290_09395) 2064088..2064558 + 471 WP_011333089.1 cytochrome c-type biogenesis protein CcmH -
QR290_RS09400 (QR290_09400) 2064555..2065757 + 1203 WP_289204772.1 c-type cytochrome biogenesis protein CcmI -
QR290_RS09405 (QR290_09405) 2065783..2066190 + 408 WP_115077021.1 hypothetical protein -
QR290_RS09410 (QR290_09410) 2066243..2066746 - 504 WP_205350854.1 PIN domain-containing protein -
QR290_RS09415 (QR290_09415) 2066828..2067295 - 468 WP_007959254.1 helix-turn-helix domain-containing protein -
QR290_RS09420 (QR290_09420) 2067379..2068266 - 888 WP_289204773.1 LysR family transcriptional regulator -
QR290_RS09425 (QR290_09425) 2068437..2068649 + 213 WP_085611511.1 type II toxin-antitoxin system HicA family toxin Toxin
QR290_RS09430 (QR290_09430) 2068649..2069053 + 405 WP_085699412.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QR290_RS09435 (QR290_09435) 2069100..2070287 - 1188 WP_289204774.1 MFS transporter -
QR290_RS09440 (QR290_09440) 2070529..2071149 + 621 WP_115077026.1 DUF5666 domain-containing protein -
QR290_RS09445 (QR290_09445) 2071205..2072203 - 999 WP_115077027.1 sulfate ABC transporter substrate-binding protein -
QR290_RS09450 (QR290_09450) 2072311..2073135 - 825 WP_115077028.1 ion transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 71 a.a.        Molecular weight: 8018.18 Da        Isoelectric Point: 10.4352

>T284487 WP_085611511.1 NZ_CP128260:2068437-2068649 [Pseudomonas fluorescens]
VQSRLLIKELEEAGWTLDRITGSHHIFTHRYNPYTIPVPHPKKDLPVGTVKSIRRRAGLYNPPASYRGDP

Download         Length: 213 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14806.76 Da        Isoelectric Point: 4.3841

>AT284487 WP_085699412.1 NZ_CP128260:2068649-2069053 [Pseudomonas fluorescens]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDTFEDAYNAAVEIAHIMLQEIAADGDSIPMPTSAAAHRNNPEFADMGWGM
LELDISPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRH

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References