Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1791655..1792276 | Replicon | chromosome |
Accession | NZ_CP128260 | ||
Organism | Pseudomonas fluorescens strain PH.SM |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QR290_RS08100 | Protein ID | WP_007957952.1 |
Coordinates | 1792097..1792276 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QR290_RS08095 | Protein ID | WP_115076874.1 |
Coordinates | 1791655..1792062 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR290_RS08070 (QR290_08070) | 1787375..1788145 | + | 771 | WP_115076869.1 | trans-aconitate 2-methyltransferase | - |
QR290_RS08075 (QR290_08075) | 1788185..1788913 | - | 729 | WP_289204680.1 | methyltransferase domain-containing protein | - |
QR290_RS08080 (QR290_08080) | 1789433..1789801 | + | 369 | WP_115076871.1 | DUF6124 family protein | - |
QR290_RS08085 (QR290_08085) | 1789882..1791141 | - | 1260 | WP_115076872.1 | type II toxin-antitoxin system HipA family toxin | - |
QR290_RS08090 (QR290_08090) | 1791134..1791451 | - | 318 | WP_115076873.1 | helix-turn-helix transcriptional regulator | - |
QR290_RS08095 (QR290_08095) | 1791655..1792062 | - | 408 | WP_115076874.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QR290_RS08100 (QR290_08100) | 1792097..1792276 | - | 180 | WP_007957952.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QR290_RS08105 (QR290_08105) | 1792499..1792909 | - | 411 | WP_289204681.1 | PaaI family thioesterase | - |
QR290_RS08110 (QR290_08110) | 1793341..1793508 | - | 168 | WP_167443763.1 | hypothetical protein | - |
QR290_RS08115 (QR290_08115) | 1793496..1794230 | - | 735 | WP_289205275.1 | zeta toxin family protein | - |
QR290_RS08125 (QR290_08125) | 1794824..1795708 | - | 885 | WP_115076875.1 | alpha/beta hydrolase | - |
QR290_RS08130 (QR290_08130) | 1796025..1796717 | - | 693 | WP_115076876.1 | pseudouridine synthase | - |
QR290_RS08135 (QR290_08135) | 1796751..1796969 | - | 219 | WP_007957955.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6660.91 Da Isoelectric Point: 11.4113
>T284485 WP_007957952.1 NZ_CP128260:c1792276-1792097 [Pseudomonas fluorescens]
VNSRFLIGQLVADGWYLVRVRGSHHHFKHPTKPGLVTVPHPKKDLLKKTAISILQQALL
VNSRFLIGQLVADGWYLVRVRGSHHHFKHPTKPGLVTVPHPKKDLLKKTAISILQQALL
Download Length: 180 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14543.58 Da Isoelectric Point: 4.5801
>AT284485 WP_115076874.1 NZ_CP128260:c1792062-1791655 [Pseudomonas fluorescens]
MLYPIAISVGDEGHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGSPIPPASKVTLHAANPKYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQV
MLYPIAISVGDEGHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGSPIPPASKVTLHAANPKYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQV
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|