Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1791655..1792276 Replicon chromosome
Accession NZ_CP128260
Organism Pseudomonas fluorescens strain PH.SM

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QR290_RS08100 Protein ID WP_007957952.1
Coordinates 1792097..1792276 (-) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag QR290_RS08095 Protein ID WP_115076874.1
Coordinates 1791655..1792062 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QR290_RS08070 (QR290_08070) 1787375..1788145 + 771 WP_115076869.1 trans-aconitate 2-methyltransferase -
QR290_RS08075 (QR290_08075) 1788185..1788913 - 729 WP_289204680.1 methyltransferase domain-containing protein -
QR290_RS08080 (QR290_08080) 1789433..1789801 + 369 WP_115076871.1 DUF6124 family protein -
QR290_RS08085 (QR290_08085) 1789882..1791141 - 1260 WP_115076872.1 type II toxin-antitoxin system HipA family toxin -
QR290_RS08090 (QR290_08090) 1791134..1791451 - 318 WP_115076873.1 helix-turn-helix transcriptional regulator -
QR290_RS08095 (QR290_08095) 1791655..1792062 - 408 WP_115076874.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QR290_RS08100 (QR290_08100) 1792097..1792276 - 180 WP_007957952.1 type II toxin-antitoxin system HicA family toxin Toxin
QR290_RS08105 (QR290_08105) 1792499..1792909 - 411 WP_289204681.1 PaaI family thioesterase -
QR290_RS08110 (QR290_08110) 1793341..1793508 - 168 WP_167443763.1 hypothetical protein -
QR290_RS08115 (QR290_08115) 1793496..1794230 - 735 WP_289205275.1 zeta toxin family protein -
QR290_RS08125 (QR290_08125) 1794824..1795708 - 885 WP_115076875.1 alpha/beta hydrolase -
QR290_RS08130 (QR290_08130) 1796025..1796717 - 693 WP_115076876.1 pseudouridine synthase -
QR290_RS08135 (QR290_08135) 1796751..1796969 - 219 WP_007957955.1 cysteine-rich CWC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6660.91 Da        Isoelectric Point: 11.4113

>T284485 WP_007957952.1 NZ_CP128260:c1792276-1792097 [Pseudomonas fluorescens]
VNSRFLIGQLVADGWYLVRVRGSHHHFKHPTKPGLVTVPHPKKDLLKKTAISILQQALL

Download         Length: 180 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14543.58 Da        Isoelectric Point: 4.5801

>AT284485 WP_115076874.1 NZ_CP128260:c1792062-1791655 [Pseudomonas fluorescens]
MLYPIAISVGDEGHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGSPIPPASKVTLHAANPKYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQV

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References