Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 519184..519827 | Replicon | chromosome |
Accession | NZ_CP128260 | ||
Organism | Pseudomonas fluorescens strain PH.SM |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QR290_RS02280 | Protein ID | WP_289204245.1 |
Coordinates | 519184..519366 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QR290_RS02285 | Protein ID | WP_289204246.1 |
Coordinates | 519426..519827 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR290_RS02265 (QR290_02265) | 515273..516199 | + | 927 | WP_007952730.1 | serine acetyltransferase | - |
QR290_RS02270 (QR290_02270) | 516671..518632 | + | 1962 | WP_289205264.1 | choline transporter BetT | - |
QR290_RS02275 (QR290_02275) | 518657..518917 | - | 261 | WP_007952727.1 | hypothetical protein | - |
QR290_RS02280 (QR290_02280) | 519184..519366 | + | 183 | WP_289204245.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QR290_RS02285 (QR290_02285) | 519426..519827 | + | 402 | WP_289204246.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QR290_RS02290 (QR290_02290) | 519850..520887 | - | 1038 | WP_115076170.1 | LacI family DNA-binding transcriptional regulator | - |
QR290_RS02295 (QR290_02295) | 521094..523319 | + | 2226 | WP_289204247.1 | TonB-dependent receptor | - |
QR290_RS02300 (QR290_02300) | 523321..524640 | + | 1320 | WP_115076172.1 | LLM class flavin-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6778.92 Da Isoelectric Point: 10.7495
>T284483 WP_289204245.1 NZ_CP128260:519184-519366 [Pseudomonas fluorescens]
MRSREMIRMIEEGGWYLVAVKGSHHQYKHPGKPGRVTIKHPDSDLPKGTINSILKQAGLK
MRSREMIRMIEEGGWYLVAVKGSHHQYKHPGKPGRVTIKHPDSDLPKGTINSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14568.38 Da Isoelectric Point: 4.3652
>AT284483 WP_289204246.1 NZ_CP128260:519426-519827 [Pseudomonas fluorescens]
MKFPVVLHKDADSDYGVIIPDVPGCFSAGTTVAEAFDNTLEALALHYEGLVADGAPLPRIQDIDAHLENPDYAGGIWGVV
EFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSTRSGFLAAAALRELSA
MKFPVVLHKDADSDYGVIIPDVPGCFSAGTTVAEAFDNTLEALALHYEGLVADGAPLPRIQDIDAHLENPDYAGGIWGVV
EFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSTRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|