Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 432183..432699 | Replicon | chromosome |
Accession | NZ_CP128260 | ||
Organism | Pseudomonas fluorescens strain PH.SM |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QR290_RS01890 | Protein ID | WP_289204204.1 |
Coordinates | 432418..432699 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0C1VYZ2 |
Locus tag | QR290_RS01885 | Protein ID | WP_039773014.1 |
Coordinates | 432183..432428 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR290_RS01850 (QR290_01850) | 427455..428060 | + | 606 | WP_115076104.1 | adenylyl-sulfate kinase | - |
QR290_RS01855 (QR290_01855) | 428057..428842 | + | 786 | WP_289204201.1 | aspartyl/asparaginyl beta-hydroxylase domain-containing protein | - |
QR290_RS01860 (QR290_01860) | 428830..429804 | + | 975 | WP_289204202.1 | sulfotransferase family protein | - |
QR290_RS01865 (QR290_01865) | 429770..430528 | - | 759 | WP_007957673.1 | slipin family protein | - |
QR290_RS01870 (QR290_01870) | 430531..431058 | - | 528 | WP_289204203.1 | NfeD family protein | - |
QR290_RS01875 (QR290_01875) | 431255..431716 | + | 462 | WP_207984640.1 | YbaK/EbsC family protein | - |
QR290_RS01880 (QR290_01880) | 431845..432087 | + | 243 | WP_039773016.1 | DUF2789 domain-containing protein | - |
QR290_RS01885 (QR290_01885) | 432183..432428 | + | 246 | WP_039773014.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QR290_RS01890 (QR290_01890) | 432418..432699 | + | 282 | WP_289204204.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QR290_RS01895 (QR290_01895) | 432824..433252 | + | 429 | WP_011331882.1 | winged helix DNA-binding protein | - |
QR290_RS01900 (QR290_01900) | 433249..435312 | + | 2064 | WP_289204205.1 | FUSC family protein | - |
QR290_RS01905 (QR290_01905) | 435309..435518 | + | 210 | WP_007957657.1 | DUF1656 domain-containing protein | - |
QR290_RS01910 (QR290_01910) | 435515..436402 | + | 888 | WP_007957655.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10957.77 Da Isoelectric Point: 10.4588
>T284482 WP_289204204.1 NZ_CP128260:432418-432699 [Pseudomonas fluorescens]
MTYKLEFLPSAHKEWNKLGHTLRDQFKKKLAERLERPRIPADSLHGMPDCYKIKLKASGYRLVYQVIEERVVVSVVAVGK
RERGDVYENSKRR
MTYKLEFLPSAHKEWNKLGHTLRDQFKKKLAERLERPRIPADSLHGMPDCYKIKLKASGYRLVYQVIEERVVVSVVAVGK
RERGDVYENSKRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|