Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4107772..4108579 | Replicon | chromosome |
| Accession | NZ_CP128255 | ||
| Organism | Escherichia coli strain T309.Ta3 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E2S9W0 |
| Locus tag | QRX22_RS20140 | Protein ID | WP_042004473.1 |
| Coordinates | 4108193..4108579 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
| Locus tag | QRX22_RS20135 | Protein ID | WP_001285482.1 |
| Coordinates | 4107772..4108146 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRX22_RS20095 (4103747) | 4103747..4104199 | + | 453 | WP_000682723.1 | hypothetical protein | - |
| QRX22_RS20100 (4104317) | 4104317..4104550 | + | 234 | WP_021531030.1 | DUF905 family protein | - |
| QRX22_RS20105 (4104650) | 4104650..4105471 | + | 822 | WP_289201234.1 | DUF932 domain-containing protein | - |
| QRX22_RS20110 (4105471) | 4105471..4105716 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| QRX22_RS20115 (4105810) | 4105810..4106283 | + | 474 | WP_001313575.1 | antirestriction protein | - |
| QRX22_RS20120 (4106299) | 4106299..4106775 | + | 477 | WP_001186193.1 | RadC family protein | - |
| QRX22_RS20125 (4106838) | 4106838..4107059 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| QRX22_RS20130 (4107078) | 4107078..4107722 | + | 645 | WP_021531033.1 | hypothetical protein | - |
| QRX22_RS20135 (4107772) | 4107772..4108146 | + | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRX22_RS20140 (4108193) | 4108193..4108579 | + | 387 | WP_042004473.1 | TA system toxin CbtA family protein | Toxin |
| QRX22_RS20145 (4108576) | 4108576..4109068 | + | 493 | Protein_3953 | DUF5983 family protein | - |
| QRX22_RS20150 (4109147) | 4109147..4110135 | - | 989 | Protein_3954 | IS630 family transposase | - |
| QRX22_RS20155 (4110283) | 4110283..4111876 | - | 1594 | Protein_3955 | IS66 family transposase | - |
| QRX22_RS20160 (4111907) | 4111907..4112257 | - | 351 | WP_000624707.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QRX22_RS20165 (4112254) | 4112254..4112545 | - | 292 | Protein_3957 | transposase | - |
| QRX22_RS20170 (4112587) | 4112587..4112781 | + | 195 | WP_001313570.1 | DUF957 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14595.66 Da Isoelectric Point: 8.2918
>T284472 WP_042004473.1 NZ_CP128255:4108193-4108579 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 387 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT284472 WP_001285482.1 NZ_CP128255:4107772-4108146 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|