Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3790755..3791373 | Replicon | chromosome |
| Accession | NZ_CP128255 | ||
| Organism | Escherichia coli strain T309.Ta3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QRX22_RS18660 | Protein ID | WP_001291435.1 |
| Coordinates | 3791155..3791373 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QRX22_RS18655 | Protein ID | WP_000344800.1 |
| Coordinates | 3790755..3791129 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRX22_RS18645 (3785844) | 3785844..3787037 | + | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QRX22_RS18650 (3787060) | 3787060..3790209 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QRX22_RS18655 (3790755) | 3790755..3791129 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QRX22_RS18660 (3791155) | 3791155..3791373 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QRX22_RS18665 (3791546) | 3791546..3792097 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QRX22_RS18670 (3792213) | 3792213..3792683 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QRX22_RS18675 (3792847) | 3792847..3794397 | + | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QRX22_RS18680 (3794439) | 3794439..3794792 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QRX22_RS18690 (3795171) | 3795171..3795482 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QRX22_RS18695 (3795513) | 3795513..3796085 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T284471 WP_001291435.1 NZ_CP128255:3791155-3791373 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT284471 WP_000344800.1 NZ_CP128255:3790755-3791129 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |