Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3168866..3169667 Replicon chromosome
Accession NZ_CP128255
Organism Escherichia coli strain T309.Ta3

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2V687
Locus tag QRX22_RS15730 Protein ID WP_000854739.1
Coordinates 3168866..3169246 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P7R0L9
Locus tag QRX22_RS15735 Protein ID WP_001285482.1
Coordinates 3169293..3169667 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRX22_RS15695 (3164457) 3164457..3165011 - 555 WP_001001921.1 molecular chaperone YcdY -
QRX22_RS15700 (3165035) 3165035..3165772 - 738 WP_000283664.1 zinc-binding phosphatase -
QRX22_RS15705 (3165827) 3165827..3166765 - 939 WP_001357083.1 glyoxylate/hydroxypyruvate reductase GhrA -
QRX22_RS15715 (3167236) 3167236..3168079 - 844 Protein_3087 DUF4942 domain-containing protein -
QRX22_RS15720 (3168164) 3168164..3168361 - 198 WP_000772027.1 DUF957 domain-containing protein -
QRX22_RS15725 (3168381) 3168381..3168869 - 489 WP_001054232.1 DUF5983 family protein -
QRX22_RS15730 (3168866) 3168866..3169246 - 381 WP_000854739.1 TA system toxin CbtA family protein Toxin
QRX22_RS15735 (3169293) 3169293..3169667 - 375 WP_001285482.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QRX22_RS15740 (3169717) 3169717..3170361 - 645 WP_021522037.1 hypothetical protein -
QRX22_RS15745 (3170380) 3170380..3170601 - 222 WP_000692315.1 DUF987 domain-containing protein -
QRX22_RS15750 (3170664) 3170664..3171140 - 477 WP_001186193.1 RadC family protein -
QRX22_RS15755 (3171156) 3171156..3171629 - 474 WP_001313575.1 antirestriction protein -
QRX22_RS15760 (3171723) 3171723..3171968 - 246 WP_001164966.1 hypothetical protein -
QRX22_RS15765 (3171968) 3171968..3172789 - 822 WP_033559203.1 DUF932 domain-containing protein -
QRX22_RS15770 (3172968) 3172968..3173057 - 90 WP_112031555.1 DUF905 family protein -
QRX22_RS15775 (3173200) 3173200..3173655 - 456 WP_000581502.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 14214.14 Da        Isoelectric Point: 6.4773

>T284470 WP_000854739.1 NZ_CP128255:c3169246-3168866 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ

Download         Length: 381 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13791.44 Da        Isoelectric Point: 4.7511

>AT284470 WP_001285482.1 NZ_CP128255:c3169667-3169293 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V687

Antitoxin

Source ID Structure
AlphaFold DB A0A0P7R0L9

References