Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3168866..3169667 | Replicon | chromosome |
| Accession | NZ_CP128255 | ||
| Organism | Escherichia coli strain T309.Ta3 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2V687 |
| Locus tag | QRX22_RS15730 | Protein ID | WP_000854739.1 |
| Coordinates | 3168866..3169246 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
| Locus tag | QRX22_RS15735 | Protein ID | WP_001285482.1 |
| Coordinates | 3169293..3169667 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRX22_RS15695 (3164457) | 3164457..3165011 | - | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| QRX22_RS15700 (3165035) | 3165035..3165772 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QRX22_RS15705 (3165827) | 3165827..3166765 | - | 939 | WP_001357083.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QRX22_RS15715 (3167236) | 3167236..3168079 | - | 844 | Protein_3087 | DUF4942 domain-containing protein | - |
| QRX22_RS15720 (3168164) | 3168164..3168361 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| QRX22_RS15725 (3168381) | 3168381..3168869 | - | 489 | WP_001054232.1 | DUF5983 family protein | - |
| QRX22_RS15730 (3168866) | 3168866..3169246 | - | 381 | WP_000854739.1 | TA system toxin CbtA family protein | Toxin |
| QRX22_RS15735 (3169293) | 3169293..3169667 | - | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRX22_RS15740 (3169717) | 3169717..3170361 | - | 645 | WP_021522037.1 | hypothetical protein | - |
| QRX22_RS15745 (3170380) | 3170380..3170601 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| QRX22_RS15750 (3170664) | 3170664..3171140 | - | 477 | WP_001186193.1 | RadC family protein | - |
| QRX22_RS15755 (3171156) | 3171156..3171629 | - | 474 | WP_001313575.1 | antirestriction protein | - |
| QRX22_RS15760 (3171723) | 3171723..3171968 | - | 246 | WP_001164966.1 | hypothetical protein | - |
| QRX22_RS15765 (3171968) | 3171968..3172789 | - | 822 | WP_033559203.1 | DUF932 domain-containing protein | - |
| QRX22_RS15770 (3172968) | 3172968..3173057 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| QRX22_RS15775 (3173200) | 3173200..3173655 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14214.14 Da Isoelectric Point: 6.4773
>T284470 WP_000854739.1 NZ_CP128255:c3169246-3168866 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT284470 WP_001285482.1 NZ_CP128255:c3169667-3169293 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V687 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7R0L9 |