Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 994359..995013 | Replicon | chromosome |
Accession | NZ_CP128255 | ||
Organism | Escherichia coli strain T309.Ta3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QRX22_RS04910 | Protein ID | WP_000244781.1 |
Coordinates | 994606..995013 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QRX22_RS04905 | Protein ID | WP_000354046.1 |
Coordinates | 994359..994625 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRX22_RS04885 (990447) | 990447..991880 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
QRX22_RS04890 (991925) | 991925..992236 | + | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
QRX22_RS04895 (992400) | 992400..993059 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QRX22_RS04900 (993136) | 993136..994116 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
QRX22_RS04905 (994359) | 994359..994625 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QRX22_RS04910 (994606) | 994606..995013 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QRX22_RS04915 (995053) | 995053..995574 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QRX22_RS04920 (995686) | 995686..996582 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QRX22_RS04925 (996607) | 996607..997317 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QRX22_RS04930 (997323) | 997323..999056 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T284462 WP_000244781.1 NZ_CP128255:994606-995013 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|