Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 765039..765867 | Replicon | chromosome |
Accession | NZ_CP128255 | ||
Organism | Escherichia coli strain T309.Ta3 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | QRX22_RS03770 | Protein ID | WP_000854814.1 |
Coordinates | 765493..765867 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A3L5H9Y2 |
Locus tag | QRX22_RS03765 | Protein ID | WP_033559079.1 |
Coordinates | 765039..765404 (+) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRX22_RS03735 (761925) | 761925..762380 | + | 456 | WP_000581502.1 | IrmA family protein | - |
QRX22_RS03740 (762523) | 762523..762612 | + | 90 | WP_112031555.1 | DUF905 family protein | - |
QRX22_RS03745 (762791) | 762791..763612 | + | 822 | WP_289201249.1 | DUF932 domain-containing protein | - |
QRX22_RS03750 (763704) | 763704..764189 | + | 486 | WP_000214310.1 | antirestriction protein | - |
QRX22_RS03755 (764205) | 764205..764681 | + | 477 | WP_289201250.1 | RadC family protein | - |
QRX22_RS03760 (764744) | 764744..764965 | + | 222 | WP_289201251.1 | DUF987 domain-containing protein | - |
QRX22_RS03765 (765039) | 765039..765404 | + | 366 | WP_033559079.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QRX22_RS03770 (765493) | 765493..765867 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QRX22_RS03775 (765864) | 765864..766355 | + | 492 | WP_128972961.1 | DUF5983 family protein | - |
QRX22_RS03780 (766367) | 766367..766564 | + | 198 | WP_033559078.1 | DUF957 domain-containing protein | - |
QRX22_RS03785 (766649) | 766649..767494 | + | 846 | WP_112031439.1 | DUF4942 domain-containing protein | - |
QRX22_RS03795 (767793) | 767793..768299 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
QRX22_RS03800 (768377) | 768377..770218 | - | 1842 | WP_000437380.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T284461 WP_000854814.1 NZ_CP128255:765493-765867 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L5H9Y2 |