Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3082917..3083557 | Replicon | chromosome |
| Accession | NZ_CP128233 | ||
| Organism | Paralcaligenes sp. CC-YST667 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N7E01_RS17135 | Protein ID | WP_289173745.1 |
| Coordinates | 3083147..3083557 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N7E01_RS17130 | Protein ID | WP_289173744.1 |
| Coordinates | 3082917..3083147 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E01_RS17090 (N7E01_17090) | 3078227..3078598 | - | 372 | WP_289175850.1 | transposase | - |
| N7E01_RS17095 (N7E01_17095) | 3078971..3079069 | + | 99 | Protein_3363 | type 1 glutamine amidotransferase domain-containing protein | - |
| N7E01_RS17100 (N7E01_17100) | 3079439..3079792 | + | 354 | WP_289173741.1 | helix-turn-helix transcriptional regulator | - |
| N7E01_RS17105 (N7E01_17105) | 3079776..3080210 | + | 435 | WP_289175851.1 | HipA N-terminal domain-containing protein | - |
| N7E01_RS17110 (N7E01_17110) | 3080532..3080756 | - | 225 | WP_289173742.1 | putative addiction module antidote protein | - |
| N7E01_RS17115 (N7E01_17115) | 3080817..3081026 | - | 210 | Protein_3367 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N7E01_RS17120 (N7E01_17120) | 3081046..3082357 | - | 1312 | Protein_3368 | Y-family DNA polymerase | - |
| N7E01_RS17125 (N7E01_17125) | 3082318..3082752 | - | 435 | WP_289173743.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| N7E01_RS17130 (N7E01_17130) | 3082917..3083147 | + | 231 | WP_289173744.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N7E01_RS17135 (N7E01_17135) | 3083147..3083557 | + | 411 | WP_289173745.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| N7E01_RS17140 (N7E01_17140) | 3083849..3084247 | + | 399 | WP_289173746.1 | hypothetical protein | - |
| N7E01_RS17145 (N7E01_17145) | 3084331..3084714 | + | 384 | WP_289173747.1 | hypothetical protein | - |
| N7E01_RS17150 (N7E01_17150) | 3084711..3085853 | + | 1143 | WP_289173748.1 | hypothetical protein | - |
| N7E01_RS17155 (N7E01_17155) | 3085858..3086064 | + | 207 | WP_289173749.1 | hypothetical protein | - |
| N7E01_RS17160 (N7E01_17160) | 3086401..3087009 | - | 609 | WP_289173750.1 | ATP-binding cassette domain-containing protein | - |
| N7E01_RS17165 (N7E01_17165) | 3087015..3087542 | - | 528 | WP_289173751.1 | PhnD/SsuA/transferrin family substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15232.38 Da Isoelectric Point: 7.2445
>T284458 WP_289173745.1 NZ_CP128233:3083147-3083557 [Paralcaligenes sp. CC-YST667]
MLKFMLDTNICIFTIKNRPQEVREAFKRHSGQMCISTVTLMELIYGAEKSSNPERNLADVEAFAARLDVLNYDAQAAAHT
GQLRAELARVGQQIGPYDQMIAGHARSNGLIVVTNNRREFDRVPGLRIEDWVAQAG
MLKFMLDTNICIFTIKNRPQEVREAFKRHSGQMCISTVTLMELIYGAEKSSNPERNLADVEAFAARLDVLNYDAQAAAHT
GQLRAELARVGQQIGPYDQMIAGHARSNGLIVVTNNRREFDRVPGLRIEDWVAQAG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|