Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3082917..3083557 Replicon chromosome
Accession NZ_CP128233
Organism Paralcaligenes sp. CC-YST667

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N7E01_RS17135 Protein ID WP_289173745.1
Coordinates 3083147..3083557 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N7E01_RS17130 Protein ID WP_289173744.1
Coordinates 3082917..3083147 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E01_RS17090 (N7E01_17090) 3078227..3078598 - 372 WP_289175850.1 transposase -
N7E01_RS17095 (N7E01_17095) 3078971..3079069 + 99 Protein_3363 type 1 glutamine amidotransferase domain-containing protein -
N7E01_RS17100 (N7E01_17100) 3079439..3079792 + 354 WP_289173741.1 helix-turn-helix transcriptional regulator -
N7E01_RS17105 (N7E01_17105) 3079776..3080210 + 435 WP_289175851.1 HipA N-terminal domain-containing protein -
N7E01_RS17110 (N7E01_17110) 3080532..3080756 - 225 WP_289173742.1 putative addiction module antidote protein -
N7E01_RS17115 (N7E01_17115) 3080817..3081026 - 210 Protein_3367 type II toxin-antitoxin system RelE/ParE family toxin -
N7E01_RS17120 (N7E01_17120) 3081046..3082357 - 1312 Protein_3368 Y-family DNA polymerase -
N7E01_RS17125 (N7E01_17125) 3082318..3082752 - 435 WP_289173743.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
N7E01_RS17130 (N7E01_17130) 3082917..3083147 + 231 WP_289173744.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N7E01_RS17135 (N7E01_17135) 3083147..3083557 + 411 WP_289173745.1 tRNA(fMet)-specific endonuclease VapC Toxin
N7E01_RS17140 (N7E01_17140) 3083849..3084247 + 399 WP_289173746.1 hypothetical protein -
N7E01_RS17145 (N7E01_17145) 3084331..3084714 + 384 WP_289173747.1 hypothetical protein -
N7E01_RS17150 (N7E01_17150) 3084711..3085853 + 1143 WP_289173748.1 hypothetical protein -
N7E01_RS17155 (N7E01_17155) 3085858..3086064 + 207 WP_289173749.1 hypothetical protein -
N7E01_RS17160 (N7E01_17160) 3086401..3087009 - 609 WP_289173750.1 ATP-binding cassette domain-containing protein -
N7E01_RS17165 (N7E01_17165) 3087015..3087542 - 528 WP_289173751.1 PhnD/SsuA/transferrin family substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15232.38 Da        Isoelectric Point: 7.2445

>T284458 WP_289173745.1 NZ_CP128233:3083147-3083557 [Paralcaligenes sp. CC-YST667]
MLKFMLDTNICIFTIKNRPQEVREAFKRHSGQMCISTVTLMELIYGAEKSSNPERNLADVEAFAARLDVLNYDAQAAAHT
GQLRAELARVGQQIGPYDQMIAGHARSNGLIVVTNNRREFDRVPGLRIEDWVAQAG

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8473.50 Da        Isoelectric Point: 4.4883

>AT284458 WP_289173744.1 NZ_CP128233:3082917-3083147 [Paralcaligenes sp. CC-YST667]
MEQGAVFQSNRSQAIRLPKAVALPDDVKRVDVVALGRTRIITPAGESWDSWFDAVGVTPDFMAQREQPDAQEREAF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References