Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 2747651..2748309 | Replicon | chromosome |
| Accession | NZ_CP128233 | ||
| Organism | Paralcaligenes sp. CC-YST667 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N7E01_RS15160 | Protein ID | WP_289173476.1 |
| Coordinates | 2747651..2748064 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N7E01_RS15165 | Protein ID | WP_289173477.1 |
| Coordinates | 2748061..2748309 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E01_RS15135 (N7E01_15135) | 2743049..2743525 | - | 477 | WP_289173471.1 | TIGR03759 family integrating conjugative element protein | - |
| N7E01_RS15140 (N7E01_15140) | 2743671..2744765 | + | 1095 | WP_289173472.1 | hypothetical protein | - |
| N7E01_RS15145 (N7E01_15145) | 2745226..2745480 | + | 255 | WP_289173473.1 | hypothetical protein | - |
| N7E01_RS15150 (N7E01_15150) | 2745616..2746041 | + | 426 | WP_289173474.1 | hypothetical protein | - |
| N7E01_RS15155 (N7E01_15155) | 2746499..2747365 | + | 867 | WP_289173475.1 | hypothetical protein | - |
| N7E01_RS15160 (N7E01_15160) | 2747651..2748064 | - | 414 | WP_289173476.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N7E01_RS15165 (N7E01_15165) | 2748061..2748309 | - | 249 | WP_289173477.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N7E01_RS15170 (N7E01_15170) | 2748421..2748708 | + | 288 | WP_289173478.1 | hypothetical protein | - |
| N7E01_RS15175 (N7E01_15175) | 2748701..2749165 | + | 465 | WP_289173479.1 | hypothetical protein | - |
| N7E01_RS15180 (N7E01_15180) | 2749627..2750031 | + | 405 | WP_289173480.1 | group II truncated hemoglobin | - |
| N7E01_RS15185 (N7E01_15185) | 2750021..2750290 | + | 270 | WP_289173481.1 | hypothetical protein | - |
| N7E01_RS15190 (N7E01_15190) | 2750329..2751045 | - | 717 | WP_289173482.1 | SIMPL domain-containing protein | - |
| N7E01_RS15195 (N7E01_15195) | 2751082..2752230 | - | 1149 | WP_289173483.1 | M20 aminoacylase family protein | - |
| N7E01_RS15200 (N7E01_15200) | 2752365..2753309 | - | 945 | WP_289173484.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2672837..2769058 | 96221 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15104.27 Da Isoelectric Point: 4.8781
>T284456 WP_289173476.1 NZ_CP128233:c2748064-2747651 [Paralcaligenes sp. CC-YST667]
MSYLIDTNVLSELRRKAPDPGVVAWFSQRPASTLHLSVLTLGEIRKDVEGVSDEARRQTLLDWLETDLPTFFTGRVLPVD
AAVADRWGRLVATAGRPLPAIDSLLAATALEHDLVLVTRNAKDFAGLPIDIFNPWSN
MSYLIDTNVLSELRRKAPDPGVVAWFSQRPASTLHLSVLTLGEIRKDVEGVSDEARRQTLLDWLETDLPTFFTGRVLPVD
AAVADRWGRLVATAGRPLPAIDSLLAATALEHDLVLVTRNAKDFAGLPIDIFNPWSN
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|