Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2544754..2545310 | Replicon | chromosome |
Accession | NZ_CP128233 | ||
Organism | Paralcaligenes sp. CC-YST667 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | N7E01_RS14000 | Protein ID | WP_289175822.1 |
Coordinates | 2545044..2545310 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7E01_RS13995 | Protein ID | WP_289173302.1 |
Coordinates | 2544754..2545047 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E01_RS13980 (N7E01_13980) | 2540950..2541822 | + | 873 | WP_289173300.1 | PAS domain S-box protein | - |
N7E01_RS13985 (N7E01_13985) | 2541974..2543488 | + | 1515 | WP_289175821.1 | PAS domain-containing protein | - |
N7E01_RS13990 (N7E01_13990) | 2543506..2544615 | + | 1110 | WP_289173301.1 | EAL domain-containing response regulator | - |
N7E01_RS13995 (N7E01_13995) | 2544754..2545047 | - | 294 | WP_289173302.1 | putative addiction module antidote protein | Antitoxin |
N7E01_RS14000 (N7E01_14000) | 2545044..2545310 | - | 267 | WP_289175822.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E01_RS14005 (N7E01_14005) | 2545635..2546954 | + | 1320 | WP_289173303.1 | IS1380 family transposase | - |
N7E01_RS14015 (N7E01_14015) | 2547518..2548294 | - | 777 | WP_289173304.1 | flagellar brake protein | - |
N7E01_RS14020 (N7E01_14020) | 2548447..2549545 | - | 1099 | Protein_2756 | AI-2E family transporter | - |
N7E01_RS14025 (N7E01_14025) | 2549728..2550309 | + | 582 | WP_289173306.1 | glycosyltransferase family 39 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10012.47 Da Isoelectric Point: 10.3118
>T284454 WP_289175822.1 NZ_CP128233:c2545310-2545044 [Paralcaligenes sp. CC-YST667]
MAGLKDLRARAKIIIRSQQASQGNFGDVKPISDGVWEMRIHFGPGYRVYYAREGRTVYLLLTGGNKSSQKRDIETAVAMW
KQIQEEQP
MAGLKDLRARAKIIIRSQQASQGNFGDVKPISDGVWEMRIHFGPGYRVYYAREGRTVYLLLTGGNKSSQKRDIETAVAMW
KQIQEEQP
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|