Detailed information of TA system TA284453

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /RES-TIGR02293
• Location: 2491540..2492468
• Replicon: chromosome
• Accession: NZ_CP128233
• Organism: Paralcaligenes sp. CC-YST667

Toxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: N7E01_RS13730
• Protein ID: WP_289173263.1
• Coordinates: 2491540..2492016 (-)
• Length: 159 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: N7E01_RS13735
• Protein ID: WP_289173264.1
• Coordinates: 2492016..2492468 (-)
• Length: 151 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N7E01_RS13670 (N7E01_13670)	2486710..2487732	+	1023	WP_289173253.1	hypothetical protein	-
N7E01_RS13675 (N7E01_13675)	2487724..2488104	-	381	WP_289173254.1	transcriptional regulator	-
N7E01_RS13680 (N7E01_13680)	2488106..2488276	-	171	Protein_2689	type II toxin-antitoxin system HigB family toxin	-
N7E01_RS13685 (N7E01_13685)	2488456..2488701	-	246	WP_289175816.1	type II toxin-antitoxin system YafQ family toxin	-
N7E01_RS13690 (N7E01_13690)	2488774..2489004	+	231	WP_289173255.1	HigA family addiction module antitoxin	-
N7E01_RS13695 (N7E01_13695)	2489166..2489492	-	327	WP_289173256.1	endoribonuclease MazF	-
N7E01_RS13700 (N7E01_13700)	2489492..2489734	-	243	WP_289173257.1	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	-
N7E01_RS13705 (N7E01_13705)	2489808..2490293	-	486	WP_289173258.1	DUF2442 domain-containing protein	-
N7E01_RS13710 (N7E01_13710)	2490290..2490544	-	255	WP_289173259.1	DUF4160 domain-containing protein	-
N7E01_RS13715 (N7E01_13715)	2490577..2490990	-	414	WP_289173260.1	helix-turn-helix domain-containing protein	-
N7E01_RS13720 (N7E01_13720)	2490987..2491274	-	288	WP_289173261.1	type II toxin-antitoxin system HigB family toxin	-
N7E01_RS13725 (N7E01_13725)	2491289..2491426	-	138	WP_289173262.1	hypothetical protein	-
N7E01_RS13730 (N7E01_13730)	2491540..2492016	-	477	WP_289173263.1	RES family NAD+ phosphorylase	Toxin
N7E01_RS13735 (N7E01_13735)	2492016..2492468	-	453	WP_289173264.1	DUF2384 domain-containing protein	Antitoxin
N7E01_RS13740 (N7E01_13740)	2492723..2493025	+	303	WP_289173265.1	hypothetical protein	-
N7E01_RS13745 (N7E01_13745)	2493132..2494217	-	1086	WP_289175870.1	hypothetical protein	-
N7E01_RS13750 (N7E01_13750)	2494138..2494800	+	663	WP_289175817.1	hypothetical protein	-
N7E01_RS13755 (N7E01_13755)	2494821..2495445	-	625	Protein_2704	C40 family peptidase	-
N7E01_RS13760 (N7E01_13760)	2495611..2496015	+	405	WP_289173266.1	heme-binding protein	-
N7E01_RS13765 (N7E01_13765)	2496052..2497371	+	1320	WP_289175818.1	MFS transporter	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• RES domain (3-138)

Antitoxin

• Antitoxin Xre-like, helix-turn-helix domain (32-93)

Sequences

Toxin

Protein

• Length: 159 a.a.
• Molecular weight: 17792.39 Da
• Isoelectric Point: 7.2044

>T284453 WP_289173263.1 NZ_CP128233:c2492016-2491540 [Paralcaligenes sp. CC-YST667]
MRTVWRITTTRFAQSAFSGEGARLYGGRWNPKGWEVVYTAQSQSLALLELMVQDDPLRAHYVLIPAKLPADLPETRIDVD
QLPEDWRTIGARDVLQTMGQAWLQEAQTAVLNVPSAVVPAERNILINPRHPDFARIVLGEPQSLQTDTRLLRNLGKPI

Nucleotide

• Length: 477 bp

Antitoxin

Protein

• Length: 151 a.a.
• Molecular weight: 16208.54 Da
• Isoelectric Point: 6.0907

>AT284453 WP_289173264.1 NZ_CP128233:c2492468-2492016 [Paralcaligenes sp. CC-YST667]
MTTASLHPSFVSAVNLLGGEAVLHARPRVMMDWIPLVRQGLPSASVDAVVRITRITQSELAHALAIPERTLARRKREGAL
SPEESAKFVRFARVVERAETVFEDADSALNWLQSQNAALGGVTPLSLLDTEIGADSVLDTLGRIEHGVFA

Nucleotide

• Length: 453 bp