Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 2491540..2492468 | Replicon | chromosome |
| Accession | NZ_CP128233 | ||
| Organism | Paralcaligenes sp. CC-YST667 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | N7E01_RS13730 | Protein ID | WP_289173263.1 |
| Coordinates | 2491540..2492016 (-) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | N7E01_RS13735 | Protein ID | WP_289173264.1 |
| Coordinates | 2492016..2492468 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E01_RS13670 (N7E01_13670) | 2486710..2487732 | + | 1023 | WP_289173253.1 | hypothetical protein | - |
| N7E01_RS13675 (N7E01_13675) | 2487724..2488104 | - | 381 | WP_289173254.1 | transcriptional regulator | - |
| N7E01_RS13680 (N7E01_13680) | 2488106..2488276 | - | 171 | Protein_2689 | type II toxin-antitoxin system HigB family toxin | - |
| N7E01_RS13685 (N7E01_13685) | 2488456..2488701 | - | 246 | WP_289175816.1 | type II toxin-antitoxin system YafQ family toxin | - |
| N7E01_RS13690 (N7E01_13690) | 2488774..2489004 | + | 231 | WP_289173255.1 | HigA family addiction module antitoxin | - |
| N7E01_RS13695 (N7E01_13695) | 2489166..2489492 | - | 327 | WP_289173256.1 | endoribonuclease MazF | - |
| N7E01_RS13700 (N7E01_13700) | 2489492..2489734 | - | 243 | WP_289173257.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| N7E01_RS13705 (N7E01_13705) | 2489808..2490293 | - | 486 | WP_289173258.1 | DUF2442 domain-containing protein | - |
| N7E01_RS13710 (N7E01_13710) | 2490290..2490544 | - | 255 | WP_289173259.1 | DUF4160 domain-containing protein | - |
| N7E01_RS13715 (N7E01_13715) | 2490577..2490990 | - | 414 | WP_289173260.1 | helix-turn-helix domain-containing protein | - |
| N7E01_RS13720 (N7E01_13720) | 2490987..2491274 | - | 288 | WP_289173261.1 | type II toxin-antitoxin system HigB family toxin | - |
| N7E01_RS13725 (N7E01_13725) | 2491289..2491426 | - | 138 | WP_289173262.1 | hypothetical protein | - |
| N7E01_RS13730 (N7E01_13730) | 2491540..2492016 | - | 477 | WP_289173263.1 | RES family NAD+ phosphorylase | Toxin |
| N7E01_RS13735 (N7E01_13735) | 2492016..2492468 | - | 453 | WP_289173264.1 | DUF2384 domain-containing protein | Antitoxin |
| N7E01_RS13740 (N7E01_13740) | 2492723..2493025 | + | 303 | WP_289173265.1 | hypothetical protein | - |
| N7E01_RS13745 (N7E01_13745) | 2493132..2494217 | - | 1086 | WP_289175870.1 | hypothetical protein | - |
| N7E01_RS13750 (N7E01_13750) | 2494138..2494800 | + | 663 | WP_289175817.1 | hypothetical protein | - |
| N7E01_RS13755 (N7E01_13755) | 2494821..2495445 | - | 625 | Protein_2704 | C40 family peptidase | - |
| N7E01_RS13760 (N7E01_13760) | 2495611..2496015 | + | 405 | WP_289173266.1 | heme-binding protein | - |
| N7E01_RS13765 (N7E01_13765) | 2496052..2497371 | + | 1320 | WP_289175818.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 17792.39 Da Isoelectric Point: 7.2044
>T284453 WP_289173263.1 NZ_CP128233:c2492016-2491540 [Paralcaligenes sp. CC-YST667]
MRTVWRITTTRFAQSAFSGEGARLYGGRWNPKGWEVVYTAQSQSLALLELMVQDDPLRAHYVLIPAKLPADLPETRIDVD
QLPEDWRTIGARDVLQTMGQAWLQEAQTAVLNVPSAVVPAERNILINPRHPDFARIVLGEPQSLQTDTRLLRNLGKPI
MRTVWRITTTRFAQSAFSGEGARLYGGRWNPKGWEVVYTAQSQSLALLELMVQDDPLRAHYVLIPAKLPADLPETRIDVD
QLPEDWRTIGARDVLQTMGQAWLQEAQTAVLNVPSAVVPAERNILINPRHPDFARIVLGEPQSLQTDTRLLRNLGKPI
Download Length: 477 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16208.54 Da Isoelectric Point: 6.0907
>AT284453 WP_289173264.1 NZ_CP128233:c2492468-2492016 [Paralcaligenes sp. CC-YST667]
MTTASLHPSFVSAVNLLGGEAVLHARPRVMMDWIPLVRQGLPSASVDAVVRITRITQSELAHALAIPERTLARRKREGAL
SPEESAKFVRFARVVERAETVFEDADSALNWLQSQNAALGGVTPLSLLDTEIGADSVLDTLGRIEHGVFA
MTTASLHPSFVSAVNLLGGEAVLHARPRVMMDWIPLVRQGLPSASVDAVVRITRITQSELAHALAIPERTLARRKREGAL
SPEESAKFVRFARVVERAETVFEDADSALNWLQSQNAALGGVTPLSLLDTEIGADSVLDTLGRIEHGVFA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|