Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 2489166..2489734 Replicon chromosome
Accession NZ_CP128233
Organism Paralcaligenes sp. CC-YST667

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag N7E01_RS13695 Protein ID WP_289173256.1
Coordinates 2489166..2489492 (-) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag N7E01_RS13700 Protein ID WP_289173257.1
Coordinates 2489492..2489734 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E01_RS13665 (N7E01_13665) 2485073..2486536 - 1464 WP_289173252.1 IS5 family transposase -
N7E01_RS13670 (N7E01_13670) 2486710..2487732 + 1023 WP_289173253.1 hypothetical protein -
N7E01_RS13675 (N7E01_13675) 2487724..2488104 - 381 WP_289173254.1 transcriptional regulator -
N7E01_RS13680 (N7E01_13680) 2488106..2488276 - 171 Protein_2689 type II toxin-antitoxin system HigB family toxin -
N7E01_RS13685 (N7E01_13685) 2488456..2488701 - 246 WP_289175816.1 type II toxin-antitoxin system YafQ family toxin -
N7E01_RS13690 (N7E01_13690) 2488774..2489004 + 231 WP_289173255.1 HigA family addiction module antitoxin -
N7E01_RS13695 (N7E01_13695) 2489166..2489492 - 327 WP_289173256.1 endoribonuclease MazF Toxin
N7E01_RS13700 (N7E01_13700) 2489492..2489734 - 243 WP_289173257.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
N7E01_RS13705 (N7E01_13705) 2489808..2490293 - 486 WP_289173258.1 DUF2442 domain-containing protein -
N7E01_RS13710 (N7E01_13710) 2490290..2490544 - 255 WP_289173259.1 DUF4160 domain-containing protein -
N7E01_RS13715 (N7E01_13715) 2490577..2490990 - 414 WP_289173260.1 helix-turn-helix domain-containing protein -
N7E01_RS13720 (N7E01_13720) 2490987..2491274 - 288 WP_289173261.1 type II toxin-antitoxin system HigB family toxin -
N7E01_RS13725 (N7E01_13725) 2491289..2491426 - 138 WP_289173262.1 hypothetical protein -
N7E01_RS13730 (N7E01_13730) 2491540..2492016 - 477 WP_289173263.1 RES family NAD+ phosphorylase -
N7E01_RS13735 (N7E01_13735) 2492016..2492468 - 453 WP_289173264.1 DUF2384 domain-containing protein -
N7E01_RS13740 (N7E01_13740) 2492723..2493025 + 303 WP_289173265.1 hypothetical protein -
N7E01_RS13745 (N7E01_13745) 2493132..2494217 - 1086 WP_289175870.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2478488..2492016 13528


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-92)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11902.69 Da        Isoelectric Point: 10.6889

>T284452 WP_289173256.1 NZ_CP128233:c2489492-2489166 [Paralcaligenes sp. CC-YST667]
MGAYVPEEADIVWLNFTPQSGHEQAGRRPAVVLSPKAYNQRSGLLVCVPITSQIKGYPFEVVLSQSGASGAALADQVKSL
DWKTRQAEKKGLPPRAKWPKSRPRSRRC

Download         Length: 327 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8804.03 Da        Isoelectric Point: 5.0080

>AT284452 WP_289173257.1 NZ_CP128233:c2489734-2489492 [Paralcaligenes sp. CC-YST667]
MAHQIVKKWGNSPAIRLPAAVMEAAHLTLEQAVEVRAENGRIVIEPATPTYSLDDLLAGMTDKNRHTEQDFGLPQGQELL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References