Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 1377744..1378419 | Replicon | chromosome |
Accession | NZ_CP128233 | ||
Organism | Paralcaligenes sp. CC-YST667 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | N7E01_RS07410 | Protein ID | WP_289175276.1 |
Coordinates | 1378057..1378419 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | N7E01_RS07405 | Protein ID | WP_289175759.1 |
Coordinates | 1377744..1378067 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E01_RS07385 (N7E01_07385) | 1374361..1375521 | - | 1161 | WP_289175272.1 | hypothetical protein | - |
N7E01_RS07390 (N7E01_07390) | 1375937..1376188 | - | 252 | WP_289175758.1 | helix-turn-helix transcriptional regulator | - |
N7E01_RS07395 (N7E01_07395) | 1376238..1376614 | - | 377 | Protein_1452 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N7E01_RS07400 (N7E01_07400) | 1376814..1377563 | - | 750 | WP_289175274.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
N7E01_RS07405 (N7E01_07405) | 1377744..1378067 | - | 324 | WP_289175759.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N7E01_RS07410 (N7E01_07410) | 1378057..1378419 | - | 363 | WP_289175276.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E01_RS07415 (N7E01_07415) | 1378552..1378821 | - | 270 | WP_289175760.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
N7E01_RS07420 (N7E01_07420) | 1378917..1379204 | - | 288 | WP_289175277.1 | helix-turn-helix domain-containing protein | - |
N7E01_RS07425 (N7E01_07425) | 1379302..1380540 | + | 1239 | WP_289175279.1 | tyrosine-type recombinase/integrase | - |
N7E01_RS07430 (N7E01_07430) | 1380569..1380733 | - | 165 | WP_289175280.1 | hypothetical protein | - |
N7E01_RS07435 (N7E01_07435) | 1380720..1381388 | - | 669 | WP_289175282.1 | hypothetical protein | - |
N7E01_RS07440 (N7E01_07440) | 1381532..1381813 | + | 282 | WP_289175284.1 | hypothetical protein | - |
N7E01_RS07445 (N7E01_07445) | 1381850..1382506 | + | 657 | WP_289175286.1 | NUDIX hydrolase | - |
N7E01_RS07450 (N7E01_07450) | 1382503..1383093 | - | 591 | WP_289175288.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13267.30 Da Isoelectric Point: 9.6418
>T284450 WP_289175276.1 NZ_CP128233:c1378419-1378057 [Paralcaligenes sp. CC-YST667]
MSPTIKPLRWIASSKKDLMAMPNDVQDTFGYALHLAQNGHKHPDAKPLKGFGGAGVLEVVEDFKGDTYRAVYTVRYLDTV
YVLHCFQKKSTQGISTPKPDVELIKARLKAIEAGIGGHRD
MSPTIKPLRWIASSKKDLMAMPNDVQDTFGYALHLAQNGHKHPDAKPLKGFGGAGVLEVVEDFKGDTYRAVYTVRYLDTV
YVLHCFQKKSTQGISTPKPDVELIKARLKAIEAGIGGHRD
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|