Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/PRK09812-MazE |
Location | 1344967..1345559 | Replicon | chromosome |
Accession | NZ_CP128233 | ||
Organism | Paralcaligenes sp. CC-YST667 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N7E01_RS07230 | Protein ID | WP_289175223.1 |
Coordinates | 1345212..1345559 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | N7E01_RS07225 | Protein ID | WP_289175220.1 |
Coordinates | 1344967..1345212 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E01_RS07195 (N7E01_07195) | 1340598..1340774 | - | 177 | WP_289175208.1 | hypothetical protein | - |
N7E01_RS07200 (N7E01_07200) | 1340849..1341172 | + | 324 | WP_289175210.1 | hypothetical protein | - |
N7E01_RS07205 (N7E01_07205) | 1341066..1342339 | + | 1274 | Protein_1414 | hypothetical protein | - |
N7E01_RS07210 (N7E01_07210) | 1342336..1342596 | - | 261 | WP_289175211.1 | hypothetical protein | - |
N7E01_RS07215 (N7E01_07215) | 1342595..1343011 | + | 417 | WP_289175214.1 | hypothetical protein | - |
N7E01_RS07220 (N7E01_07220) | 1343008..1344858 | + | 1851 | WP_289175217.1 | nucleoside-diphosphate sugar epimerase/dehydratase | - |
N7E01_RS07225 (N7E01_07225) | 1344967..1345212 | + | 246 | WP_289175220.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N7E01_RS07230 (N7E01_07230) | 1345212..1345559 | + | 348 | WP_289175223.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N7E01_RS07235 (N7E01_07235) | 1345655..1347097 | - | 1443 | WP_289175225.1 | TolC family outer membrane protein | - |
N7E01_RS07240 (N7E01_07240) | 1347158..1348501 | - | 1344 | WP_289175227.1 | HlyD family type I secretion periplasmic adaptor subunit | - |
N7E01_RS07245 (N7E01_07245) | 1348503..1349879 | - | 1377 | WP_289175228.1 | type I secretion system permease/ATPase | - |
N7E01_RS07250 (N7E01_07250) | 1349885..1350244 | - | 360 | WP_289175230.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12372.20 Da Isoelectric Point: 6.8593
>T284449 WP_289175223.1 NZ_CP128233:1345212-1345559 [Paralcaligenes sp. CC-YST667]
MAYVPNRGDIVHLEFDPSSGNEIKGPHFGLVLSAKVFNQQGLAMICPISQGAAAAARTYGTVVTLMGSGTDTQGAVHCHQ
LKSLDWQARKVRLKETAPQPIVDEVLARVEAILFD
MAYVPNRGDIVHLEFDPSSGNEIKGPHFGLVLSAKVFNQQGLAMICPISQGAAAAARTYGTVVTLMGSGTDTQGAVHCHQ
LKSLDWQARKVRLKETAPQPIVDEVLARVEAILFD
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|