Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
| Location | 1299459..1299978 | Replicon | chromosome |
| Accession | NZ_CP128233 | ||
| Organism | Paralcaligenes sp. CC-YST667 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N7E01_RS06985 | Protein ID | WP_289175146.1 |
| Coordinates | 1299706..1299978 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | N7E01_RS06980 | Protein ID | WP_289175142.1 |
| Coordinates | 1299459..1299716 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E01_RS06950 (N7E01_06950) | 1294895..1295622 | + | 728 | Protein_1363 | cyclase family protein | - |
| N7E01_RS06955 (N7E01_06955) | 1295648..1296376 | + | 729 | WP_289175132.1 | SDR family oxidoreductase | - |
| N7E01_RS06960 (N7E01_06960) | 1296576..1296842 | + | 267 | WP_289175134.1 | helix-turn-helix domain-containing protein | - |
| N7E01_RS06965 (N7E01_06965) | 1296839..1298145 | + | 1307 | Protein_1366 | HipA domain-containing protein | - |
| N7E01_RS06970 (N7E01_06970) | 1298184..1298870 | + | 687 | WP_289175137.1 | MFS transporter | - |
| N7E01_RS06975 (N7E01_06975) | 1298908..1299357 | + | 450 | WP_289175139.1 | MFS transporter | - |
| N7E01_RS06980 (N7E01_06980) | 1299459..1299716 | + | 258 | WP_289175142.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| N7E01_RS06985 (N7E01_06985) | 1299706..1299978 | + | 273 | WP_289175146.1 | Txe/YoeB family addiction module toxin | Toxin |
| N7E01_RS06990 (N7E01_06990) | 1299892..1303695 | - | 3804 | Protein_1371 | hydantoinase B/oxoprolinase family protein | - |
| N7E01_RS06995 (N7E01_06995) | 1303895..1304170 | + | 276 | WP_289175147.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| N7E01_RS07000 (N7E01_07000) | 1304170..1304562 | + | 393 | WP_289175756.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10808.48 Da Isoelectric Point: 8.2656
>T284448 WP_289175146.1 NZ_CP128233:1299706-1299978 [Paralcaligenes sp. CC-YST667]
MPTRPEPKLLWTIAAWQDYEYWQGQDKKTLKRINTLIKDCMRHPFEGLGKPEPLKENLSGFWSRRIDDTHRLVYCVDEQG
LVIIACRYHY
MPTRPEPKLLWTIAAWQDYEYWQGQDKKTLKRINTLIKDCMRHPFEGLGKPEPLKENLSGFWSRRIDDTHRLVYCVDEQG
LVIIACRYHY
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|