Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 1049064..1049686 | Replicon | chromosome |
Accession | NZ_CP128233 | ||
Organism | Paralcaligenes sp. CC-YST667 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N7E01_RS05580 | Protein ID | WP_289174880.1 |
Coordinates | 1049064..1049372 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7E01_RS05585 | Protein ID | WP_289174881.1 |
Coordinates | 1049375..1049686 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E01_RS05555 (N7E01_05555) | 1045022..1046002 | - | 981 | WP_289174875.1 | diguanylate cyclase | - |
N7E01_RS05560 (N7E01_05560) | 1046033..1046959 | - | 927 | WP_289174876.1 | WYL domain-containing protein | - |
N7E01_RS05565 (N7E01_05565) | 1047282..1047551 | + | 270 | WP_289174877.1 | CopG family transcriptional regulator | - |
N7E01_RS05570 (N7E01_05570) | 1047538..1047906 | + | 369 | WP_289174878.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N7E01_RS05575 (N7E01_05575) | 1048172..1048864 | - | 693 | WP_289174879.1 | nitroreductase | - |
N7E01_RS05580 (N7E01_05580) | 1049064..1049372 | + | 309 | WP_289174880.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E01_RS05585 (N7E01_05585) | 1049375..1049686 | + | 312 | WP_289174881.1 | putative addiction module antidote protein | Antitoxin |
N7E01_RS05590 (N7E01_05590) | 1050042..1050796 | - | 755 | Protein_1091 | NYN domain-containing protein | - |
N7E01_RS05595 (N7E01_05595) | 1050904..1051218 | - | 315 | WP_289174882.1 | NIPSNAP family protein | - |
N7E01_RS05600 (N7E01_05600) | 1051290..1051826 | - | 537 | WP_289174883.1 | DUF2058 domain-containing protein | - |
N7E01_RS05605 (N7E01_05605) | 1051842..1052186 | - | 345 | WP_289174884.1 | zinc ribbon domain-containing protein YjdM | - |
N7E01_RS05610 (N7E01_05610) | 1052548..1052898 | + | 351 | WP_289174885.1 | CocE/NonD family hydrolase | - |
N7E01_RS05615 (N7E01_05615) | 1052826..1053452 | + | 627 | WP_289175746.1 | CocE/NonD family hydrolase | - |
N7E01_RS05620 (N7E01_05620) | 1053403..1054491 | + | 1089 | WP_289174886.1 | CocE/NonD family hydrolase | - |
N7E01_RS05625 (N7E01_05625) | 1054478..1054630 | + | 153 | WP_289174887.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11813.64 Da Isoelectric Point: 9.7777
>T284447 WP_289174880.1 NZ_CP128233:1049064-1049372 [Paralcaligenes sp. CC-YST667]
MYTIKSLPEFDAWFDSLKDPTTRARLIRRLEKAERGLLGDVEPVGEGVNEMREFFGPGWRMYYIEQGDVLIVMLGGGSKV
TQTRDIKRAKKLARTLRYDEKT
MYTIKSLPEFDAWFDSLKDPTTRARLIRRLEKAERGLLGDVEPVGEGVNEMREFFGPGWRMYYIEQGDVLIVMLGGGSKV
TQTRDIKRAKKLARTLRYDEKT
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|