Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 373291..373868 | Replicon | chromosome |
Accession | NZ_CP128233 | ||
Organism | Paralcaligenes sp. CC-YST667 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N7E01_RS01855 | Protein ID | WP_289174363.1 |
Coordinates | 373291..373671 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N7E01_RS01860 | Protein ID | WP_289174365.1 |
Coordinates | 373668..373868 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E01_RS01825 (N7E01_01825) | 368529..369800 | + | 1272 | WP_289175707.1 | hydantoinase B/oxoprolinase family protein | - |
N7E01_RS01830 (N7E01_01830) | 369806..370267 | + | 462 | WP_289174355.1 | hypothetical protein | - |
N7E01_RS01835 (N7E01_01835) | 370549..371154 | + | 606 | WP_289174356.1 | hypothetical protein | - |
N7E01_RS01840 (N7E01_01840) | 371049..372233 | + | 1185 | WP_289174358.1 | GTP-binding protein | - |
N7E01_RS01845 (N7E01_01845) | 372280..372717 | + | 438 | WP_289174359.1 | hypothetical protein | - |
N7E01_RS01850 (N7E01_01850) | 372757..373242 | + | 486 | WP_289174361.1 | nucleoside 2-deoxyribosyltransferase | - |
N7E01_RS01855 (N7E01_01855) | 373291..373671 | - | 381 | WP_289174363.1 | PIN domain-containing protein | Toxin |
N7E01_RS01860 (N7E01_01860) | 373668..373868 | - | 201 | WP_289174365.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N7E01_RS01865 (N7E01_01865) | 374170..374811 | - | 642 | WP_289174367.1 | lipocalin family protein | - |
N7E01_RS01870 (N7E01_01870) | 374848..375639 | - | 792 | WP_289174369.1 | hypothetical protein | - |
N7E01_RS01875 (N7E01_01875) | 375686..376483 | - | 798 | WP_289174371.1 | histidinol-phosphatase | - |
N7E01_RS01880 (N7E01_01880) | 376662..377710 | - | 1049 | Protein_368 | NADP(H)-dependent aldo-keto reductase | - |
N7E01_RS01885 (N7E01_01885) | 377880..378352 | - | 473 | Protein_369 | Dps family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14333.88 Da Isoelectric Point: 6.8614
>T284445 WP_289174363.1 NZ_CP128233:c373671-373291 [Paralcaligenes sp. CC-YST667]
MRRVLVDTSVWVEHFRNPNQALIELLLHDQVKIHPLIIGELACGTPPDRRNTLALLENLAQVRQASISEAMVFIERERLY
GQGCGLVDLLLLSSALMTEQTLIWTLDKRFGALAIRFNLMFMPVAH
MRRVLVDTSVWVEHFRNPNQALIELLLHDQVKIHPLIIGELACGTPPDRRNTLALLENLAQVRQASISEAMVFIERERLY
GQGCGLVDLLLLSSALMTEQTLIWTLDKRFGALAIRFNLMFMPVAH
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|