Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1919841..1920406 | Replicon | chromosome |
Accession | NZ_CP128231 | ||
Organism | Paraburkholderia bonniea strain BbQS395 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QS306_RS08365 | Protein ID | WP_153075451.1 |
Coordinates | 1919841..1920212 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QS306_RS08370 | Protein ID | WP_153075452.1 |
Coordinates | 1920209..1920406 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QS306_RS08355 (QS306_08355) | 1917308..1917613 | + | 306 | WP_286273106.1 | hypothetical protein | - |
QS306_RS08360 (QS306_08360) | 1918193..1918974 | - | 782 | Protein_1624 | IS5 family transposase | - |
QS306_RS08365 (QS306_08365) | 1919841..1920212 | - | 372 | WP_153075451.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QS306_RS08370 (QS306_08370) | 1920209..1920406 | - | 198 | WP_153075452.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QS306_RS08375 (QS306_08375) | 1920539..1921625 | + | 1087 | Protein_1627 | IS3 family transposase | - |
QS306_RS08380 (QS306_08380) | 1921828..1923570 | - | 1743 | WP_286273107.1 | 30S ribosomal protein S12 methylthiotransferase accessory factor YcaO | - |
QS306_RS08385 (QS306_08385) | 1924124..1925395 | - | 1272 | WP_286273108.1 | DUF1214 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1916960..1931808 | 14848 | |
- | flank | IS/Tn | - | - | 1921167..1921415 | 248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13604.82 Da Isoelectric Point: 5.1298
>T284444 WP_153075451.1 NZ_CP128231:c1920212-1919841 [Paraburkholderia bonniea]
MILVDTSVWIDHINASDPMLITLLAEERVLAHPYVIGEISLGSLRSRDVVLGALLDLPRAPVATPDETFYLIEREGLFNR
GIGYVDTSLLASARLQPGITIWTRDKRLKKVADELNLGAMLAH
MILVDTSVWIDHINASDPMLITLLAEERVLAHPYVIGEISLGSLRSRDVVLGALLDLPRAPVATPDETFYLIEREGLFNR
GIGYVDTSLLASARLQPGITIWTRDKRLKKVADELNLGAMLAH
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|