Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 223080..223605 | Replicon | plasmid F |
Accession | NZ_CP128219 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QSI84_RS22960 | Protein ID | WP_001159868.1 |
Coordinates | 223080..223385 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QSI84_RS22965 | Protein ID | WP_000813634.1 |
Coordinates | 223387..223605 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS22945 (218990) | 218990..220156 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QSI84_RS22950 (220744) | 220744..221499 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QSI84_RS22955 (222273) | 222273..223079 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QSI84_RS22960 (223080) | 223080..223385 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QSI84_RS22965 (223387) | 223387..223605 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QSI84_RS22970 (224185) | 224185..225273 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
QSI84_RS22975 (225275) | 225275..227500 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
QSI84_RS22980 (227550) | 227550..228449 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 1..232324 | 232324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T284442 WP_001159868.1 NZ_CP128219:c223385-223080 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|