Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 176579..177204 | Replicon | plasmid F |
Accession | NZ_CP128219 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QSI84_RS22660 | Protein ID | WP_000911324.1 |
Coordinates | 176806..177204 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | QSI84_RS22655 | Protein ID | WP_000450532.1 |
Coordinates | 176579..176806 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS22655 (176579) | 176579..176806 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QSI84_RS22660 (176806) | 176806..177204 | + | 399 | WP_000911324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QSI84_RS22665 (177213) | 177213..179366 | - | 2154 | WP_053905128.1 | type IV conjugative transfer system coupling protein TraD | - |
QSI84_RS22670 (179619) | 179619..180350 | - | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
QSI84_RS22675 (180375) | 180375..180896 | - | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 1..232324 | 232324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T284438 WP_000911324.1 NZ_CP128219:176806-177204 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|