Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 88839..89518 Replicon plasmid F
Accession NZ_CP128219
Organism Escherichia coli strain TG1

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag QSI84_RS22240 Protein ID WP_000854672.1
Coordinates 89177..89518 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag QSI84_RS22235 Protein ID WP_000070395.1
Coordinates 88839..89156 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSI84_RS22185 (83886) 83886..84749 + 864 WP_001065553.1 GTPase family protein -
QSI84_RS22190 (84841) 84841..85662 + 822 WP_000197389.1 DUF932 domain-containing protein -
QSI84_RS22195 (85879) 85879..86070 + 192 Protein_83 DeoR family transcriptional regulator -
QSI84_RS22200 (86066) 86066..86293 + 228 WP_001548158.1 protein YpjK -
QSI84_RS22205 (86293) 86293..86736 + 444 WP_000824223.1 lipoprotein YafY -
QSI84_RS22210 (86759) 86759..87226 + 468 WP_001547765.1 protein YkfB -
QSI84_RS22215 (87303) 87303..87542 + 240 WP_000194654.1 DUF905 family protein -
QSI84_RS22220 (87640) 87640..88098 + 459 WP_000211838.1 antirestriction protein -
QSI84_RS22225 (88114) 88114..88590 + 477 WP_000811693.1 RadC family protein -
QSI84_RS22230 (88599) 88599..88820 + 222 WP_000691994.1 DUF987 domain-containing protein -
QSI84_RS22235 (88839) 88839..89156 + 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
QSI84_RS22240 (89177) 89177..89518 + 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
QSI84_RS22250 (90090) 90090..91343 - 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
QSI84_RS22255 (91355) 91355..92458 - 1104 WP_001285288.1 glutamate 5-kinase -
QSI84_RS22260 (92746) 92746..93801 + 1056 WP_000749863.1 phosphoporin PhoE -
QSI84_RS22265 (93840) 93840..94241 - 402 WP_000174689.1 sigma factor-binding protein Crl -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 1..232324 232324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T284435 WP_000854672.1 NZ_CP128219:89177-89518 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT284435 WP_000070395.1 NZ_CP128219:88839-89156 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References