Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 88839..89518 | Replicon | plasmid F |
Accession | NZ_CP128219 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | QSI84_RS22240 | Protein ID | WP_000854672.1 |
Coordinates | 89177..89518 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | QSI84_RS22235 | Protein ID | WP_000070395.1 |
Coordinates | 88839..89156 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS22185 (83886) | 83886..84749 | + | 864 | WP_001065553.1 | GTPase family protein | - |
QSI84_RS22190 (84841) | 84841..85662 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
QSI84_RS22195 (85879) | 85879..86070 | + | 192 | Protein_83 | DeoR family transcriptional regulator | - |
QSI84_RS22200 (86066) | 86066..86293 | + | 228 | WP_001548158.1 | protein YpjK | - |
QSI84_RS22205 (86293) | 86293..86736 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
QSI84_RS22210 (86759) | 86759..87226 | + | 468 | WP_001547765.1 | protein YkfB | - |
QSI84_RS22215 (87303) | 87303..87542 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
QSI84_RS22220 (87640) | 87640..88098 | + | 459 | WP_000211838.1 | antirestriction protein | - |
QSI84_RS22225 (88114) | 88114..88590 | + | 477 | WP_000811693.1 | RadC family protein | - |
QSI84_RS22230 (88599) | 88599..88820 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
QSI84_RS22235 (88839) | 88839..89156 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
QSI84_RS22240 (89177) | 89177..89518 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
QSI84_RS22250 (90090) | 90090..91343 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
QSI84_RS22255 (91355) | 91355..92458 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
QSI84_RS22260 (92746) | 92746..93801 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
QSI84_RS22265 (93840) | 93840..94241 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 1..232324 | 232324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T284435 WP_000854672.1 NZ_CP128219:89177-89518 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|