Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4154660..4155474 | Replicon | chromosome |
Accession | NZ_CP128218 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | QSI84_RS20285 | Protein ID | WP_001054376.1 |
Coordinates | 4155217..4155474 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | QSI84_RS20280 | Protein ID | WP_001309181.1 |
Coordinates | 4154660..4155205 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS20250 (4150351) | 4150351..4151664 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
QSI84_RS20255 (4151676) | 4151676..4151954 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
QSI84_RS20260 (4151951) | 4151951..4153072 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
QSI84_RS20265 (4153317) | 4153317..4153433 | - | 117 | Protein_3940 | VOC family protein | - |
QSI84_RS20270 (4153471) | 4153471..4153689 | - | 219 | Protein_3941 | hypothetical protein | - |
QSI84_RS20275 (4153858) | 4153858..4154604 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
QSI84_RS20280 (4154660) | 4154660..4155205 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
QSI84_RS20285 (4155217) | 4155217..4155474 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
QSI84_RS20290 (4155965) | 4155965..4156096 | - | 132 | WP_001309182.1 | hypothetical protein | - |
QSI84_RS20295 (4156212) | 4156212..4157452 | + | 1241 | Protein_3946 | helicase YjhR | - |
QSI84_RS20300 (4157720) | 4157720..4157925 | - | 206 | Protein_3947 | HNH endonuclease | - |
QSI84_RS20305 (4158035) | 4158035..4159015 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
QSI84_RS20310 (4159080) | 4159080..4160186 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4154660..4170118 | 15458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T284433 WP_001054376.1 NZ_CP128218:c4155474-4155217 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT284433 WP_001309181.1 NZ_CP128218:c4155205-4154660 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|