Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2659912..2660566 | Replicon | chromosome |
Accession | NZ_CP128218 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QSI84_RS13065 | Protein ID | WP_000244777.1 |
Coordinates | 2659912..2660319 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QSI84_RS13070 | Protein ID | WP_000354046.1 |
Coordinates | 2660300..2660566 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS13045 (2655869) | 2655869..2657602 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QSI84_RS13050 (2657608) | 2657608..2658318 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QSI84_RS13055 (2658343) | 2658343..2659239 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QSI84_RS13060 (2659351) | 2659351..2659872 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
QSI84_RS13065 (2659912) | 2659912..2660319 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
QSI84_RS13070 (2660300) | 2660300..2660566 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QSI84_RS13075 (2660809) | 2660809..2661789 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QSI84_RS13080 (2661985) | 2661985..2662644 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
QSI84_RS13085 (2662808) | 2662808..2663119 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
QSI84_RS13090 (2663164) | 2663164..2664597 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
QSI84_RS13095 (2664654) | 2664654..2665397 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T284427 WP_000244777.1 NZ_CP128218:c2660319-2659912 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |