Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2396611..2397278 | Replicon | chromosome |
Accession | NZ_CP128218 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | QSI84_RS11840 | Protein ID | WP_001094400.1 |
Coordinates | 2396949..2397278 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | QSI84_RS11835 | Protein ID | WP_000072690.1 |
Coordinates | 2396611..2396928 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS11805 (2391663) | 2391663..2392672 | - | 1010 | Protein_2306 | arsenic transporter | - |
QSI84_RS11810 (2392814) | 2392814..2394517 | + | 1704 | WP_000896263.1 | protein YfjW | - |
QSI84_RS11815 (2395128) | 2395128..2395312 | + | 185 | Protein_2308 | DUF905 family protein | - |
QSI84_RS11820 (2395415) | 2395415..2395873 | + | 459 | WP_000211841.1 | antirestriction protein | - |
QSI84_RS11825 (2395882) | 2395882..2396364 | + | 483 | WP_001407480.1 | RadC family protein | - |
QSI84_RS11830 (2396373) | 2396373..2396573 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
QSI84_RS11835 (2396611) | 2396611..2396928 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QSI84_RS11840 (2396949) | 2396949..2397278 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
QSI84_RS11845 (2397642) | 2397642..2402222 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T284425 WP_001094400.1 NZ_CP128218:2396949-2397278 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |