Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1700586..1701417 | Replicon | chromosome |
| Accession | NZ_CP128218 | ||
| Organism | Escherichia coli strain TG1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QSI84_RS08550 | Protein ID | WP_000854814.1 |
| Coordinates | 1701043..1701417 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | QSI84_RS08545 | Protein ID | WP_001285584.1 |
| Coordinates | 1700586..1700954 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSI84_RS08530 (1698253) | 1698253..1699785 | + | 1533 | WP_001350525.1 | protein YeeR | - |
| QSI84_RS08535 (1699782) | 1699782..1700228 | + | 447 | WP_000187523.1 | RadC family protein | - |
| QSI84_RS08540 (1700291) | 1700291..1700512 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QSI84_RS08545 (1700586) | 1700586..1700954 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QSI84_RS08550 (1701043) | 1701043..1701417 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QSI84_RS08555 (1701414) | 1701414..1701608 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QSI84_RS08560 (1701654) | 1701654..1701734 | + | 81 | Protein_1671 | hypothetical protein | - |
| QSI84_RS08565 (1702023) | 1702023..1702151 | - | 129 | Protein_1672 | transposase domain-containing protein | - |
| QSI84_RS08570 (1702271) | 1702271..1702405 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| QSI84_RS08575 (1702506) | 1702506..1702835 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QSI84_RS08580 (1703007) | 1703007..1704065 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| QSI84_RS08585 (1704263) | 1704263..1704736 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| QSI84_RS08590 (1704855) | 1704855..1706021 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T284422 WP_000854814.1 NZ_CP128218:1701043-1701417 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT284422 WP_001285584.1 NZ_CP128218:1700586-1700954 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |