Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1131653..1132291 | Replicon | chromosome |
| Accession | NZ_CP128218 | ||
| Organism | Escherichia coli strain TG1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QSI84_RS05630 | Protein ID | WP_000813794.1 |
| Coordinates | 1131653..1131829 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QSI84_RS05635 | Protein ID | WP_001270286.1 |
| Coordinates | 1131875..1132291 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSI84_RS05610 (1127272) | 1127272..1128447 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| QSI84_RS05615 (1128539) | 1128539..1129075 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| QSI84_RS05620 (1129148) | 1129148..1131109 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QSI84_RS05625 (1131201) | 1131201..1131431 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| QSI84_RS05630 (1131653) | 1131653..1131829 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QSI84_RS05635 (1131875) | 1131875..1132291 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QSI84_RS05640 (1132370) | 1132370..1133776 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| QSI84_RS05645 (1134021) | 1134021..1135166 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| QSI84_RS05650 (1135184) | 1135184..1136197 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| QSI84_RS05655 (1136198) | 1136198..1137139 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T284415 WP_000813794.1 NZ_CP128218:1131653-1131829 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT284415 WP_001270286.1 NZ_CP128218:1131875-1132291 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|