Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 102698..103316 | Replicon | chromosome |
Accession | NZ_CP128218 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | QSI84_RS00520 | Protein ID | WP_001290581.1 |
Coordinates | 102698..102916 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QSI84_RS00525 | Protein ID | WP_000344800.1 |
Coordinates | 102942..103316 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS00485 (97987) | 97987..98559 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
QSI84_RS00490 (98590) | 98590..98901 | - | 312 | WP_000409911.1 | MGMT family protein | - |
QSI84_RS00500 (99280) | 99280..99633 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QSI84_RS00505 (99675) | 99675..101225 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QSI84_RS00510 (101389) | 101389..101859 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QSI84_RS00515 (101975) | 101975..102526 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QSI84_RS00520 (102698) | 102698..102916 | - | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
QSI84_RS00525 (102942) | 102942..103316 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QSI84_RS00530 (103862) | 103862..107011 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QSI84_RS00535 (107034) | 107034..108227 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T284411 WP_001290581.1 NZ_CP128218:c102916-102698 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT284411 WP_000344800.1 NZ_CP128218:c103316-102942 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|