Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 1568937..1569544 | Replicon | chromosome |
Accession | NZ_CP128214 | ||
Organism | Agrobacterium fabrum strain ARqua1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q7D0B7 |
Locus tag | QOV31_RS07720 | Protein ID | WP_010971265.1 |
Coordinates | 1569209..1569544 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A9CJP8 |
Locus tag | QOV31_RS07715 | Protein ID | WP_010971266.1 |
Coordinates | 1568937..1569212 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOV31_RS07685 (QOV31_001526) | 1564093..1564452 | - | 360 | WP_006311244.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
QOV31_RS07690 (QOV31_001527) | 1564452..1564718 | - | 267 | WP_010971270.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
QOV31_RS07695 (QOV31_001528) | 1564788..1564988 | - | 201 | WP_006311242.1 | heavy-metal-associated domain-containing protein | - |
QOV31_RS07700 (QOV31_001529) | 1565041..1565463 | - | 423 | WP_006311241.1 | Cu(I)-responsive transcriptional regulator | - |
QOV31_RS07705 (QOV31_001530) | 1565460..1568045 | - | 2586 | WP_035256421.1 | heavy metal translocating P-type ATPase | - |
QOV31_RS07710 (QOV31_001531) | 1568221..1568829 | - | 609 | WP_010971267.1 | class I SAM-dependent methyltransferase | - |
QOV31_RS07715 (QOV31_001532) | 1568937..1569212 | + | 276 | WP_010971266.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QOV31_RS07720 (QOV31_001533) | 1569209..1569544 | + | 336 | WP_010971265.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QOV31_RS07725 (QOV31_001534) | 1569572..1570396 | - | 825 | WP_010971264.1 | class D beta-lactamase | - |
QOV31_RS07730 (QOV31_001535) | 1570508..1570987 | - | 480 | WP_010971263.1 | YcgN family cysteine cluster protein | - |
QOV31_RS07735 (QOV31_001536) | 1571244..1573439 | + | 2196 | WP_035256415.1 | transglycosylase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12991.86 Da Isoelectric Point: 10.0059
>T284409 WP_010971265.1 NZ_CP128214:1569209-1569544 [Agrobacterium fabrum]
VTNKKDHGKDAALKRATLPRRSDFTKQFIKDWQRLNNSGRYDMVRLKEIMLLLIANGAPLPTQFRDHELTGDWRDHRECH
VGGDFLLIYTVDEKQNLLIFTRAGTHAELFR
VTNKKDHGKDAALKRATLPRRSDFTKQFIKDWQRLNNSGRYDMVRLKEIMLLLIANGAPLPTQFRDHELTGDWRDHRECH
VGGDFLLIYTVDEKQNLLIFTRAGTHAELFR
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|