Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 1564093..1564718 | Replicon | chromosome |
| Accession | NZ_CP128214 | ||
| Organism | Agrobacterium fabrum strain ARqua1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q7D0B1 |
| Locus tag | QOV31_RS07685 | Protein ID | WP_006311244.1 |
| Coordinates | 1564093..1564452 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q7D0B2 |
| Locus tag | QOV31_RS07690 | Protein ID | WP_010971270.1 |
| Coordinates | 1564452..1564718 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOV31_RS07665 (QOV31_001522) | 1560231..1561949 | + | 1719 | WP_035256424.1 | glycoside hydrolase family 32 protein | - |
| QOV31_RS07670 (QOV31_001523) | 1562018..1562191 | + | 174 | WP_010971273.1 | hypothetical protein | - |
| QOV31_RS07675 (QOV31_001524) | 1562270..1563658 | - | 1389 | WP_169539085.1 | MFS transporter | - |
| QOV31_RS07680 (QOV31_001525) | 1563837..1564085 | + | 249 | WP_006311245.1 | hypothetical protein | - |
| QOV31_RS07685 (QOV31_001526) | 1564093..1564452 | - | 360 | WP_006311244.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QOV31_RS07690 (QOV31_001527) | 1564452..1564718 | - | 267 | WP_010971270.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QOV31_RS07695 (QOV31_001528) | 1564788..1564988 | - | 201 | WP_006311242.1 | heavy-metal-associated domain-containing protein | - |
| QOV31_RS07700 (QOV31_001529) | 1565041..1565463 | - | 423 | WP_006311241.1 | Cu(I)-responsive transcriptional regulator | - |
| QOV31_RS07705 (QOV31_001530) | 1565460..1568045 | - | 2586 | WP_035256421.1 | heavy metal translocating P-type ATPase | - |
| QOV31_RS07710 (QOV31_001531) | 1568221..1568829 | - | 609 | WP_010971267.1 | class I SAM-dependent methyltransferase | - |
| QOV31_RS07715 (QOV31_001532) | 1568937..1569212 | + | 276 | WP_010971266.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| QOV31_RS07720 (QOV31_001533) | 1569209..1569544 | + | 336 | WP_010971265.1 | type II toxin-antitoxin system YafQ family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12857.04 Da Isoelectric Point: 8.2782
>T284408 WP_006311244.1 NZ_CP128214:c1564452-1564093 [Agrobacterium fabrum]
MVRNQIPKRGDVYLVDLNPVVGSEIKDEHRCVVITPREINAVGLCLVVPVTTGGMFTRKAGLAVNISGHKTTGVALCNQV
RSMDIVARVAQKKAKYIETLDDATIDEIAGRVISMIDPA
MVRNQIPKRGDVYLVDLNPVVGSEIKDEHRCVVITPREINAVGLCLVVPVTTGGMFTRKAGLAVNISGHKTTGVALCNQV
RSMDIVARVAQKKAKYIETLDDATIDEIAGRVISMIDPA
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|