Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 2221537..2222081 | Replicon | chromosome |
| Accession | NZ_CP128204 | ||
| Organism | Vibrio furnissii strain VFBJ05 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QSU95_RS10325 | Protein ID | WP_172559614.1 |
| Coordinates | 2221537..2221836 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0Q2N1Z8 |
| Locus tag | QSU95_RS10330 | Protein ID | WP_055466056.1 |
| Coordinates | 2221824..2222081 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSU95_RS10295 (QSU95_10295) | 2216878..2217606 | + | 729 | WP_004725097.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| QSU95_RS10300 (QSU95_10300) | 2217616..2218473 | + | 858 | WP_004725096.1 | flagellar motor stator protein MotA | - |
| QSU95_RS10305 (QSU95_10305) | 2218473..2219465 | + | 993 | WP_154180241.1 | flagellar motor protein MotB | - |
| QSU95_RS10310 (QSU95_10310) | 2219540..2219827 | + | 288 | WP_232658001.1 | hypothetical protein | - |
| QSU95_RS10315 (QSU95_10315) | 2219964..2220494 | + | 531 | WP_055466057.1 | copper resistance protein NlpE | - |
| QSU95_RS10320 (QSU95_10320) | 2220834..2221109 | + | 276 | WP_004725092.1 | hypothetical protein | - |
| QSU95_RS10325 (QSU95_10325) | 2221537..2221836 | - | 300 | WP_172559614.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QSU95_RS10330 (QSU95_10330) | 2221824..2222081 | - | 258 | WP_055466056.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QSU95_RS10335 (QSU95_10335) | 2222229..2222705 | - | 477 | WP_286210994.1 | sensor protein | - |
| QSU95_RS10340 (QSU95_10340) | 2222772..2222861 | - | 90 | WP_286212344.1 | DUF3265 domain-containing protein | - |
| QSU95_RS10345 (QSU95_10345) | 2222889..2223812 | - | 924 | WP_286210996.1 | hypothetical protein | - |
| QSU95_RS10350 (QSU95_10350) | 2223910..2223999 | - | 90 | Protein_1992 | DUF3265 domain-containing protein | - |
| QSU95_RS10355 (QSU95_10355) | 2223971..2224930 | - | 960 | WP_286210997.1 | hypothetical protein | - |
| QSU95_RS10360 (QSU95_10360) | 2225399..2226163 | - | 765 | WP_004725087.1 | IclR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11475.40 Da Isoelectric Point: 4.8604
>T284405 WP_172559614.1 NZ_CP128204:c2221836-2221537 [Vibrio furnissii]
MAEIIWTEPALSDLNDIAEYIALENVAAAKQLVQTIFAKVERLENFPESGRIPPELAHLSYRELVVNPCRIFYKFDGDKV
FILFVMRSERDLRKFLLGM
MAEIIWTEPALSDLNDIAEYIALENVAAAKQLVQTIFAKVERLENFPESGRIPPELAHLSYRELVVNPCRIFYKFDGDKV
FILFVMRSERDLRKFLLGM
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|